CAZyme Information: ASPZODRAFT_2035767-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_2035767-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	KV878343|CGC5	52412.01	6.0172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878343:231409-232855(-)

Full Sequence      

MATATYQQMLRDLFDENVLAKLVRTAIEALEDNSPPTAYPEFVPDGPSATGQYFLRDAEF
WTCGFFPGLLYLLVERAVKYPRVFPYYSRNPDDNRLNPTALRQKLLALCDSWTQPLHAMA
TRTDTHDLGFIIQPALCTSWELTGNEHSLQLVLTAAHSLATRYDPRVRAIRSWDALRQVN
VEITSLTDDFLVIVDSMCNLDLLYYAAHHTADRTLSDIATAHAHTIISSILRRESPHTTV
PTNSRYNGPLFSTCHVVNFDPRTGSVKERRTAQGYSHDSTWARGQAWAILGFAQTYTWTH
EQEFLSTACGLAEYFLQQLEAAPSCVERHGRYVPLWDFDAPIEDLDSPLRDSSAGVIAAN
GMLVLSQALLAEGNTKLADRFRVAAMRIVSETLTHCLANKAKFIGRVSSPEEDISVSDVG
RRFDAILQHATANHNAGDHDRYSDHGLVYADYYLVEFGNKLLRMGFA

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_2035767-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	56	457	1.3e-89	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	0.005	259	296	166	205	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27314.1|GH88	1.30e-192	10	465	7	460
EAA59462.1|GH88	2.63e-177	7	465	9	487
QBZ63971.1|GH88	1.56e-165	10	466	12	485
UQC88796.1|GH88	2.27e-162	13	465	68	514
UPK92483.1|GH88	5.81e-162	2	465	36	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.96e-30	19	366	32	320	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.47e-23	53	319	60	282	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.50e-23	53	319	61	283	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	1.14e-22	53	319	61	283	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	1.14e-22	53	319	61	283	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	4.47e-32	16	456	42	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	8.70e-29	39	319	48	284	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	5.94e-24	39	319	45	281	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.29e-22	53	319	61	283	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.76e-20	43	369	27	296	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999635	0.000384

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_2035767-t33_1-p1.