CAZyme Information: ASPZODRAFT_1970012-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_1970012-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	KV878342|CGC1	39509.73	5.4866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878342:510243-511384(+)

Full Sequence      

MIIPRFYLFILASVAFIGIWFLSYKPFLYQQLSVSQSTDGGRSLPLNHSLPPLEAAGNET
LGFQKILILSTGPSWRTRGLLAAAHLTGLQITIPPQPPIDEAIVDAFGQLGGDDDDEEHP
PHGATIAWLAHLDLIKHAIQLDLETVLIIEDDVDWDVSIRHQMVRIASAIRNLTHTEQRD
QSSHPTPYGHDWDLLWIGHCGEFWNEDFETVSFEDRSACPKAQYSGWARNYLSHLPDHHR
SIYWSFNPVCSFAYALSRKGMRNVLRVAGGGRGEAFDVKVMQACKAKALRCISVVPEVVH
QYFPAASYGVNSLVDIGNGEAVGPDETEFESVMGSTDNILESARCNALWGKTCLR

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_1970012-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.12e-04	128	156	68	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD59205.1|GT25	1.90e-151	51	355	60	360
BAE58653.1|GT25	1.48e-150	51	355	140	440
QMW28939.1|GT25	2.20e-150	51	355	60	360
QMW41014.1|GT25	2.20e-150	51	355	60	360
QRD85193.1|GT25	2.62e-149	51	355	132	432

PDB Hits     

ASPZODRAFT_1970012-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPZODRAFT_1970012-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999908	0.000123

TMHMM  Annotations     

Start	End
7	24