CAZyme Information: ASPZODRAFT_1947666-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_1947666-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	KV878341|CGC8	41170.90	5.0225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878341:1472310-1473630(-)

Full Sequence      

MFPTMASLALRRQAPLYGLGVAAIVMIILPASLFIWPAHPVPIAAGDHLVAHQDPIRNGT
LGFQKIFAINLPTRSDKRDNLILASALSNIHIEFVDGVTADEVNPASYPYNWHTEFTQTE
YGVRRAHINAMERIVEEGLGSALIIEDDADWDVSLKTQLQSFAHAVRALQGADEAISPYG
DAWDVLWMGHCGITCAEQAPYFMADSDPTVLPPSHFLPYWRDGPSIERAADSRIICPVSD
GVCMPFYAVSAVGARRLLSALSVSPADVAGVVDSGAQIDVALGRICGSGFLRCFAPYPSL
TGGYRAAGPENKGSDIHQADAVGKVEIKPAWSWGVMYSVMMNVHRLLYGDGTVHANWEDL
PVLDVDPHSIPVVGGQQFRV

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_1947666-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	63	263	4.1e-23	0.9558011049723757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	3.43e-21	65	152	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.06e-06	63	261	1	189	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	6.55e-06	62	269	1	182	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25421.1|GT25	1.01e-140	11	375	8	378
BCS04381.1|GT25	7.62e-139	16	378	15	371
BCS15969.1|GT25	7.62e-139	16	378	15	371
CAK40570.1|GT25	8.77e-128	16	375	15	368
CAP99059.1|GT25	1.82e-127	56	378	54	379

PDB Hits     

ASPZODRAFT_1947666-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PMF6|GT251_DANRE	2.61e-08	55	189	314	450	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1
sp|Q8NBJ5|GT251_HUMAN	3.38e-07	61	189	338	468	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|A7MB73|GT253_BOVIN	4.38e-07	42	199	300	457	Probable inactive glycosyltransferase 25 family member 3 OS=Bos taurus OX=9913 GN=CERCAM PE=2 SV=1
sp|Q8K297|GT251_MOUSE	5.91e-07	61	189	333	463	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|A5PK45|GT251_BOVIN	7.87e-07	61	189	339	469	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000006

TMHMM  Annotations     

Start	End
16	38