CAZyme Information: ASPZODRAFT_167328-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_167328-t33_1-p1
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	KV878344|CGC3	52019.10	6.6568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878344:49483-51018(+)

Full Sequence      

MMIDSIISIAFYISTVLTVLIWLLPSQYGQADASAQQAPKCKVQILVLGDIGRSPRMQYH
ALSIARKGGQVDIIGYNESEPHPDVSSHPNISIVPLPPHPAVLQTSNRILFLLYGPLKVL
FQIGCLWVCLAYRTKPAKWLLVQNPPSIPSLAVASIVCFCRKTHLVIDWHNFGYSILALK
LGPRHPLVRWSKWYEKTFCRYATAHLCVTRAMARVLKEDFALQAPILPLHDRPADLFQPI
PDEKDRTRFLTSLPETEPIRAALEGSGNARVLVSSTSWTPDEDFSILLDALCQYSEIATS
MAQKPEDSLPHIMAIITGKGPQREQYLKRIAELENAGKLEHATVRTTWLSMQDYARLLAS
ASLGVSLHTSSSGVDLPMKVVDMFGAGLPVVGCQFEAWPELVHEGVNGRGFETATELADH
LVDLFGHPDRLDTLRDGACIESTRRWDSEWDPVAGKLFGLVDSEVKID

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	41	456	2.9e-160	0.9929411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	43	458	6	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	4.66e-152	40	425	4	371	transferase, transferring glycosyl groups
223515	RfaB	2.93e-17	48	457	14	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	2.43e-13	52	457	15	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340825	GT4_WbuB-like	4.04e-07	49	449	12	386	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX64524.1|GT33	1.08e-234	2	462	1	460
BCS01601.1|GT33	2.44e-233	2	461	1	459
BCS13317.1|GT33	2.44e-233	2	461	1	459
CAK39183.1|GT33	2.44e-233	2	461	1	459
QRD93281.1|GT33	2.31e-231	2	461	1	459

PDB Hits     

ASPZODRAFT_167328-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	4.19e-146	21	461	20	446	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|Q6C3K2|ALG1_YARLI	1.36e-104	45	460	44	440	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|O13933|ALG1_SCHPO	1.65e-101	36	453	20	415	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q8L7M0|TUN_ARATH	6.82e-93	45	465	9	462	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|Q921Q3|ALG1_MOUSE	4.38e-92	45	450	37	453	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000006

TMHMM  Annotations     

Start	End
5	24
109	131