CAZyme Information: ASPZODRAFT_16054-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_16054-t33_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	KV878341|CGC7	23556.51	3.6259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878341:1456580-1457273(+)

Full Sequence      

MKAFLLSALATLSLASAPPAKRQITTSTTGTSDGWYYSFWTNGGGTVDYTNDDGGEYTVT
WEDCGDFTCGKGWEVGSERDITFSADFSPSGNAYLAVYGWTENPLIEYYILENYGDYDPG
TEMTYMGSVESDGSLYYIYEHEQVDQPSVESDSSTFMQYWSIRVDLRSEGTVTTANHFAA
WEELGMSLGSDFNYQIMLTEGYESSGSSIVTVS

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	34	210	2.1e-66	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	1.58e-90	35	208	3	174	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVD69635.1|GH11	1.61e-105	21	213	26	218
AQY10337.1|GH11	3.15e-98	7	213	12	217
ACR92595.1|GH11|3.2.1.8	1.46e-97	21	213	30	221
BAA88421.1|GH11|3.2.1.8	1.46e-97	21	213	30	221
ACP27610.1|GH11	1.27e-90	21	213	26	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TE1_B	3.69e-87	22	213	1	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
3WP3_A	2.66e-86	20	213	15	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
5HXV_A	1.35e-82	24	213	3	190	Chain A, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_B Chain B, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_C Chain C, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_D Chain D, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_E Chain E, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_F Chain F, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_G Chain G, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_H Chain H, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_I Chain I, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_J Chain J, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_K Chain K, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_L Chain L, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612]
7DFM_A	2.70e-71	24	213	5	191	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1H1A_A	1.13e-69	24	212	3	190	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W0HJ53|XYN2_RHIOR	5.58e-87	21	213	26	216	Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae OX=64495 GN=xyn2 PE=1 SV=1
sp|Q9HFH0|XYNC_TALFU	2.01e-86	20	213	31	223	Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus OX=28572 GN=xynC PE=1 SV=1
sp|P55333|XYNB_EMENI	4.26e-78	25	213	35	221	Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnB PE=2 SV=2
sp|Q2PGY1|XYNA_PENCI	5.29e-78	15	213	20	217	Endo-1,4-beta-xylanase A OS=Penicillium citrinum OX=5077 GN=xynA PE=1 SV=1
sp|A1DNU5|XYNB_NEOFI	1.21e-77	20	213	30	221	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999731	CS pos: 22-23. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_16054-t33_1-p1.