CAZyme Information: ASPZODRAFT_160113-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_160113-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	KV878344|CGC7	68847.99	3.6874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878344:959401-961402(+)

Full Sequence      

MLPLLLLSLLSKSAALNLTVSSSGGNTSSTLQYGLLFEDIYHSGDGGLYGEMIRNRAFQG
SSVDGVVSLDRTTDFWTEVGGVTLSVDTETTPLSSSLPAQLRMEVPEDTTTAVGFYNDGF
WGFDVDASQRYIASMYVYGNYTGDVTCYFYSTTSDTILGSTTISLDQTESDGWVQTYSPT
FYPTTTASNANNTFYFVFEDGAQLAGESLYFNVLSVFKQTYNNRANGLRTDMAEAVAALG
TKYIRLPGGNNMEGLYAPYYWKWNETLGSLTERPGRPGTWGDYNTDGFGLIEMMLMADDM
GLEVILGVWAGLYLDGTVVAEADLQPYVDSVMDELEFLLGDSSTTYGAQREALGYGAFTI
NYIEIGNEDYLNGGTTSYDDYRFTAFYDAIHATYPDISLISTINPSPVTTDGSPVDLHLY
GDADYFVTLFNAFDQASRSYPVFVNEYAATNTGSNSASQIGAQTLSMACAEAVFLLGCER
NSDVVVGSAYGALIKNYNEAPDTVAVIKQTASEVLYSMSFYVQQLFAANMGSSTLPVTAT
DGELAPVYWSATTNTSHTILKLVNYDGETGADSAVSVTLEGSSADTATLISFSAPEADSI
NNLAALGGETSSVTTTALQGEAGVFTVEFSSAYEILILVA

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_160113-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214830	Alpha-L-AF_C	1.18e-19	464	614	19	184	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
399741	Alpha-L-AF_C	1.40e-12	464	629	23	188	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
226064	AbfA	3.52e-12	222	370	44	175	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD94840.1|GH51	0.0	7	639	7	638
QMW33494.1|GH51	0.0	7	639	7	638
QMW45534.1|GH51	0.0	7	639	7	638
UDD62290.1|GH51	0.0	7	639	11	642
BAE63854.1|GH51	0.0	7	639	7	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	3.36e-105	19	596	4	585	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P42254|ABFA_ASPNG	2.87e-132	5	597	15	590	Alpha-L-arabinofuranosidase A OS=Aspergillus niger OX=5061 GN=abfA PE=1 SV=1
sp|A2Q7E0|ABFA_ASPNC	2.87e-132	5	597	15	590	Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfA PE=3 SV=1
sp|Q0CTV2|ABFA_ASPTN	4.05e-132	5	597	15	590	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|Q8NK90|ABFA_ASPKW	1.78e-130	5	597	15	590	Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfA PE=1 SV=2
sp|Q96X54|ABFA_ASPAW	3.53e-130	5	597	15	590	Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori OX=105351 GN=abfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000340	0.999661	CS pos: 15-16. Pr: 0.9643

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_160113-t33_1-p1.