CAZyme Information: ASPZODRAFT_153910-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_153910-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		69827.28	6.1004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878349:11823-13790(+)

Full Sequence      

MEYPRPDFQRTPLKWASLNGPWDFLFDDSDSGLSSWPRHGLPDKNKTTIQVPFAFQTAAS
GINDQSAHEVIWYERRIRDLRSGQQVSSERLLLRFGAVDYECSVWVDGVFAGEHRGGHVP
FDLEISSLTSPEKEHRLTIRVRDSPSDLTQPRGKQYWAPIPESIFYTPTSGIWQSVWLES
VPRVRLGDASQGTLLRSDDLQSGLLHARIVVLGRQAGASVRVEMEARLGGRLVGVAASDL
PKDQEFALLDLDMKVKESRHEGLDWQNDVAVWSPQHPTLYDLRLRLLDGSNTLLDEVHTT
TGMRRLSWSNGDGSFRLNGQPIFQLLVLDQGYWPHTGLTPPSQQALKDDIQRAQAMGFTG
CRKHQKVEDPVFLYWADRLGYLVWGEMANAYAFGHEYIDRFNAEWTAAVRRDINHPSVIA
WTPVNESWGYPALKGDVHQRNHLRSLYYLTKTLDDSRPVNDNCGWEHVHTDLTTFHDYAD
AADLARTCASLDGILGPKADHAMFVQPLHPDNQQHDAGSRHSPGAPVICTEFGGVNIAPA
RDSPAGERDWGYTTALDAADLLARLERLVMAVAGGHTCGLVYTQLYDIEQEVNGLYTYDR
KAKIPPEEVKKIMQRAFRQG

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_153910-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	481	2.5e-97	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.99e-26	17	460	14	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	9.16e-26	17	459	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	2.78e-13	7	459	32	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	6.39e-11	17	182	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
397119	Glyco_hydro_2_C	3.60e-10	312	485	5	191	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91609.1|GH2	2.35e-303	3	616	4	638
QMW47280.1|GH2	2.35e-303	3	616	4	638
QMW35218.1|GH2	2.35e-303	3	616	4	638
CAP80802.1|GH2	9.94e-300	3	616	5	638
CAK44902.1|GH2	1.35e-297	3	618	4	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	5.06e-63	2	615	28	581	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	2.63e-20	17	426	29	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	2.65e-20	17	426	37	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6ED2_A	1.32e-19	3	545	30	549	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
1BHG_A	9.07e-19	1	459	7	459	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	8.20e-22	1	459	27	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|O77695|BGLR_CHLAE	3.34e-21	1	459	24	476	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
sp|O97524|BGLR_FELCA	1.04e-20	1	459	27	478	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|P77989|BGAL_THEP3	6.65e-20	18	459	19	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|P12265|BGLR_MOUSE	1.73e-19	17	459	40	475	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_153910-t33_1-p1.