CAZyme Information: ASPZODRAFT_153009-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_153009-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
917	KV878345|CGC3	102986.61	4.7606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878345:368450-371469(-)

Full Sequence      

MRLQTVLSVLSTDPSLPTIQGQHVLDLSEIGWTVSSTALNRIVPGHLPSQVHLDLYAAGV
IGRYYGLNDFNLRWIADANWTYTSEPLRDLQKDAKSSWLVFNGLDTFATVDFCGQTVGTA
DNQFRQWIFDVSQILEDCRSDPVLSINFGSAPNIVNAIANDPSSEVWPARIQEAQVFEYP
NRWFMRKEQSDFGWDWGPAFAPAGPWQPAYIVQLENEQAIYITNTDLDTYRKGQINHLPP
DQSQPWVVNASIDFIGEVPSDALMSVLVSDAKTGEILITGDMFDVTISDGSITGHTVIGA
HVPKLWWPNGLGDQNLYNFAISISTKESQTLASITKRTGFRTIFLNRLNITEDQIALGIA
PGANWHFEVNGHEFYAKGSNIIPPDTFWPRVTETKMRRLLKAVVAGNQNMLRVWASGAYL
PDFIYDIADEEGIFLWSEFQFGDALYPVDKAFLENVAAEVTYNVRRVNHHPSLALWAGGN
EIESLMLPAVKAADPTAFVSLILPLVYENTRSISYMPSSTNNGYLGVNLSSPVPMAERYW
NITPGKYYGDTDHYNYDSSVAFDTSSYPVGRFANEFGYHSMPSVQTWQQALDPQDLYFNS
SVVMLRNHHYPMGGLSTDNLSKSALGMGEMTRSVERYYPLPRHSDRIANFSAWCHATQIF
QADFYKSQIQFYRRGSGMPERQLGALYWQLEDIWQAPSWAGIEYDGRWKTLHYVAKDIYR
PIIVSPFWNHNTSVLEIYATSDLWKPAAGTVRMTWLDMAGKPLPGNAGTPSVVDFQVGAI
NTTRIYSTHFADLSLSNLTNSILILSLTATAERTESTFSHENYFTPSFPKDLALRDPHLE
LSYSKDTGKFTVKATSGVSLYTWIDYPAGIIGYFEENSFVLLPGESREVGFVMQENPSGE
DSWIKGVTVQSLWDQGN

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	738	2.6e-71	0.5957446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.12e-49	24	726	12	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	3.34e-16	836	914	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
407658	Mannosidase_ig	9.94e-10	735	831	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	3.82e-06	241	499	222	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	6.36e-05	269	341	29	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39414.1|GH2	0.0	15	915	14	927
QMW27343.1|GH2	0.0	15	915	14	927
BCS16350.1|GH2	0.0	14	915	14	928
BCS04781.1|GH2	0.0	14	915	14	928
CAK96951.1|GH2|3.2.1.25	0.0	14	915	14	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	26	914	32	938	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	5.80e-106	32	914	18	866	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	2.03e-80	27	901	10	826	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.10e-80	27	901	12	828	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.14e-80	27	901	12	828	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMS9|MANBA_ASPFU	0.0	1	915	3	922	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1
sp|B8NP78|MANBA_ASPFN	0.0	15	915	14	910	Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndA PE=3 SV=1
sp|O74168|MANBA_ASPAC	0.0	20	914	22	932	Beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=mndA PE=1 SV=1
sp|Q2UN00|MANBA_ASPOR	0.0	15	915	14	910	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	4	915	6	928	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.957817	0.042233

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_153009-t33_1-p1.