CAZyme Information: ASPZODRAFT_152981-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_152981-t33_1-p1
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	KV878345|CGC2	78761.37	6.5361

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878345:283326-285497(+)

Full Sequence      

MSYPQETFHRTHFTPGSFWAKRRAVAWQTTLPAQLAILKSTGRYDAFRMKWHPVYAEGHR
ALFWDSDVGKWLESACYFLAERAQDPDYSRMDKEGDGLIDEAVRELTAMIGTAQCRDGYL
NIRFTVVEPGKRFTNIRDLHELYNAGHLLEAALIHHQHYQNDLLLSPMLKYVDLLCETFG
PGPDQIHGYPGHPEIELALLRLYERTGHKNALKLAQFFITERGNPNGPQGQHFYLTEAEQ
RGEHPAERPWKDASELRLPYWYQQAHQPILEQQTIEGHSVRAMYLLTAVADLVRISRSST
DVRDCEGYKTACERLWNNMVDKKMYLTGGIGSRSEWEGFGVDYLLPQGWDEGGCYAETCA
SIGVMMMAERMLQLDLDGKYADIMELALYNTVLGNMSQDGKEFLYENHLASCPRRPMKRE
SWFDCACCPPNVARTMGMLGGYMWSTEVKGKDVTINVHLFNPATLKFQVGEHTVTLQQRT
NWPWNGTVVFVLDAPSSLNITIRLRVPAWTVPFEDGSRVQIRPELPAQSISKSYLMLPPE
YTSQHVKKEIEVSFSKQSMAPRLVRPHPYTSLDTVAVARGPLIYCAEDVDNDWVNDHFKS
TAISRNAHLQEIVQHNDFLDEDFLMIKTTGVKLNEEQYSNRSNGVFPGFAVTQPVEPQGE
QVPLILVPYYYRGNRGGRGHMRVGFKRSD

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	17	585	3e-160	0.9885496183206107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	9.26e-137	16	689	20	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	2.61e-118	17	585	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT01986.1|GH127	1.89e-248	1	688	1	662
ATZ54433.1|GH127	1.38e-246	1	688	1	662
CCD50963.1|GH127	9.37e-243	1	682	1	656
QKD55520.1|GH127	4.98e-241	1	684	1	667
CCT69642.1|GH127	1.37e-240	1	684	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.25e-121	18	676	22	637	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.05e-114	18	676	22	637	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.73e-91	17	683	20	621	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WKW_A	1.72e-87	57	688	67	659	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	2.60e-87	57	591	67	572	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	1.34e-86	57	591	67	572	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_152981-t33_1-p1.