CAZyme Information: ASPZODRAFT_149888-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_149888-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	KV878338|CGC5	92475.09	5.2531

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878338:412376-414993(-)

Full Sequence      

MVQLDVETILSQLTLGEKVALTAGIDFWHTAAIERLGVPSLRLSDGPNGVRGTRFFNGVP
AACFPCATALGATWDTELLHQVGRLLGEEAVAKGVHVLLGPTLNIQRSPLGGRGFESFSE
DGVLSGTLAGHYCRGVQEKGVAATLKHFVCNDQEHERLAVDTIVTARALREIYLLPFQLA
MRICQTACVMTAYNKINGTHVSENKAIIDDILRREWAWDGLVMSDWFGTYSTADAIRAGL
DLEMPGKTRWRGEALAHAVSSRKVPEHILDDRVRHVLRLINWLDRAGIPEHAPEKALNRP
EDRRLLRRAAAESIVLLKNEGDILPLKKDRSLLVIGPNAKLAAYCGGGSASLDAYYTVTP
FDGLVAQSTADVRYVQGVYSHKELPLLGPLLKTADGRTGFSFRVYNEPPTEANRELVDEL
HLVSSNGFLMDYVNPKIKSFLFYVDMEGDFTPEEDGVYDFGVTVVGTGKLLIDGEVVVDN
TKNQRQGSAFFGNGTVEEIGSKELKAGQTYRVLLQFGSAPTSDIDTRGIVVFGPGGFRFG
AARRITQTELIAQAVDQAATADQVVLFAGLTAEWETEGHDRDHMDLPPGSDELIAAVLRV
KPDAVIVIQSGTPVTMPWAPEAKALVQAWFGGNECGNGIADVLYGAVNPSAKLPLTFPVH
LRDNPSYLNFGSERGRVLYGEDVFVGYRFYEKMQRAPLFPFGYGLSYTTFSRSNLRFQVS
PEQQSSNVLADGEPITASVTVTNTGTVAGAEIVQLWITPRKEGPGIIRPVRELKAFDKVF
LQPGEEKTVRLVVEKKLATSFWDEEREAWVSEAGTYGLLITGTGDQILEDEFVVNRTRYW
VGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	2.1e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.10e-87	64	820	120	750	beta-glucosidase BglX.
224389	BglX	6.54e-76	26	340	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.03e-51	314	687	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.94e-43	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.68e-37	8	805	55	754	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA36818.1|GH3	0.0	1	843	1	838
CAP96720.1|GH3	0.0	1	843	1	840
BCS04055.1|GH3	0.0	1	843	1	839
BCS15658.1|GH3	0.0	1	843	1	839
QMW44618.1|GH3	0.0	1	843	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.13e-276	1	843	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.58e-270	5	843	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.52e-158	5	837	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.42e-117	11	816	10	644	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.85e-97	6	838	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	843	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	3	843	11	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	1	843	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	1	843	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	843	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999704	0.000318

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_149888-t33_1-p1.