CAZyme Information: ASPZODRAFT_147354-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_147354-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		65698.33	5.2189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878360:35981-37808(+)

Full Sequence      

MKAIFYLLAYVTGWSWSGLQNNQVVLPGGQTCQNTATSRHCWGEYSIETNYYTTAPSTGH
TVEVWLSVQEGMCSQDGYRRPCMTFNGTMPGPTITANWGDELVVHVTNNLQSNGTSVHWH
GIRQQHNVQNDGVPGVTQCPIAPGDTFTYRFQATQYGTSWYHSHFSLQYAEGLFGPLVIH
GPATADYDEDLGTLFLQDWSHTTSYRDWTAKAKYGITKPQQNLLINGTNTFDCPARENNE
PIDSHCVGGGRKFEAVFEAGKRYRLRLINVAVDSQFQFSIDGHNLTVIANDFVPLHPYET
ASVLINVAQRYDVIVEANAVPGDYWLRAGWVKACIGVANDHPDDSTGIIRYNADSQATPM
SISRVKPPVACLDEPFDQLVPYVPLDVTNITGTTVEDINVLLTGASFFQWTINSSSFMLD
WEHPTLMRISNGENSFPPQFNVVNVDKQSLNPKTNEWAVLVIENKAVALLGSIAHPIHLH
GHDFWLLAQSPTTWDGTTAGWQTVNPPRRDTAVLPAFGHLVVAFQLDNPGAWLVHCHIAW
HAGQGLALQFVENQGDIAFSTVERQQFDETCHKWDAWWATAPFPQEDSGI

Enzyme Prediction     

EC	1.10.3.2:4	1.10.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	49	365	4.2e-131	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.55e-77	74	552	14	523	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
259923	CuRO_1_MaLCC_like	8.66e-72	59	180	1	122	The first cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
177843	PLN02191	1.82e-68	83	552	45	546	L-ascorbate oxidase
259968	CuRO_3_MaLCC_like	2.14e-66	387	551	3	157	The third cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 3 of 3-domain MCOs contains the Type 1 (T1) copper binding site and part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
215324	PLN02604	1.72e-65	74	552	37	546	oxidoreductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ57071.1|AA1_3	3.62e-227	31	590	38	581
AAK77953.1|AA1_3	3.62e-227	31	590	38	581
CAM12502.1|AA1_3	7.28e-227	31	590	36	581
ABM21605.1|AA1_3	3.77e-225	31	590	42	584
QBZ63059.1|AA1_3	1.95e-223	30	590	40	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SQR_A	1.50e-224	31	590	38	580	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
3V9E_A	3.01e-224	31	590	38	580	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
5LWX_A	1.57e-141	42	583	32	562	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]
5LM8_A	7.32e-141	42	583	4	534	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]
5LWW_A	7.56e-141	42	583	5	535	Crystal structure of a laccase-like multicopper oxidase McoG from Aspergillus niger bound to zinc [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96WM9|LAC2_BOTFU	6.43e-228	31	590	38	581	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|Q12570|LAC1_BOTFU	1.62e-208	30	590	35	561	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|J5JH35|OPS5_BEAB2	3.06e-185	32	590	44	590	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1
sp|P78722|LAC2_PODAS	3.28e-127	30	590	46	605	Laccase-2 OS=Podospora anserina OX=2587412 GN=LAC2 PE=2 SV=1
sp|D4APX3|LAC1_ARTBC	9.26e-127	44	590	82	633	Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003001	0.996960	CS pos: 17-18. Pr: 0.7621

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_147354-t33_1-p1.