CAZyme Information: ASPZODRAFT_141589-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_141589-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	KV878340|CGC5	46374.20	2.7350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878340:1607072-1608476(-)

Full Sequence      

MVLTRLIAVAFWVTMVSAYLVTPPGSVFPGADSDCSGWVEATSGLTCAEVEAVEGITAAE
FEAWNPLILEVYSTCELETGFYYCIQVDFDSTSASSSSTSTSTSTSSSSSTSISVTITGD
GVTTPSPIQTGMISTCDDFYLVVSGDECGTIAADAGISLATFYAWNPAVGTSCAYLDVGD
YVCIGVLGGTTASPTTGSVTSTTTGDGISTPSPIQTGMVSTCDEFHLVVSGDDCATIAAD
AGISLDTFYAWNPAVGTSCAYLDLGDYVCIDIIGYTPTTTPAITSAPSTTTTSSGDGIST
PSPIQTGIVSTCNEFYLVVSGDNCATIAADAGISLATFYAWNPAVGTSCASLDVGDYVCI
DIIGYTPTATTTLATTTTTSTSTGNGVTTPTPYEPDMVTDCDVFYLVSSGDTCASIAEAE
GVTTAEIEDWNPTVGTDCTDLWLDYYICVGIL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	2.33e-09	403	447	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	3.55e-07	315	349	2	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.33e-06	225	262	2	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	1.41e-06	404	449	1	44	Lysin motif.
212030	LysM	1.07e-05	139	176	2	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53591.1|CBM50	1.34e-119	8	451	10	437
QYT04780.1|CBM50	1.94e-119	21	452	109	502
QQK44150.1|CBM50	4.52e-109	127	451	121	426
UKZ79391.1|CBM50	7.00e-108	8	451	10	424
VBB80356.1|CBM50	2.73e-95	22	452	34	458

PDB Hits     

ASPZODRAFT_141589-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.32e-82	122	452	141	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	4.49e-14	312	451	29	181	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	3.40e-13	215	272	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AZ68|LYSM3_ARTBC	4.01e-12	125	272	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.35e-11	211	451	251	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999726	CS pos: 18-19. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_141589-t33_1-p1.