CAZyme Information: ASPZODRAFT_13848-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_13848-t33_1-p1
• CAZy Family: GH135
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		84529.79	3.7733

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878338:973824-976469(-)

Full Sequence      

MRCSLVSVFSVLITVANAGLVHVPVVNEVLDSASPSSTSVAAQSHSVNGAEATSTSSSYW
LADITHQGIAAFNTDPSTYVVFRNVMDYGATGDGVTDDTAAINAAISDGGRYGPSSGESS
TTTPAIVYFPAGTYLISSSIIDYYFTQLIGDPNSLPIIKASAAFPATYMIDGDQYQDDGD
EGWTATNVFFRQIRNMILDMTDVPATTGAVGIHWPTGQATSIQNVEILMSSESGTQHEGL
FIENGSGGFVVDVTTSGGLYGIYVGNQQFTMRNLKISDAVTGISQIWDWGWTYIGLTISN
CTTAVAVNTGGSDDQAVGSVTIIDSVIEDCPVFIDTAWQSSSHSNGSLILENIYLDNVPV
AVQDNGDTILAGSSGETTIDGWGQGHKYIPDGPTNFQGTIAAPTRPTALLASGTSDYYTK
TKPQYAASPVSSFLSVRDAGAKGDGTTDDTAAIQAALESAVSSSQIVFFDQGTYKVTTTI
DVPAGSRMVGESYPVIMASGDTFADIDTPIPVVRIGTAGDSGSIEWSDMIVSTQGSTPGA
VLIEWNLAATEGSGMWDVHARIGGFDGSDLQVAECPTTASVSATCEAAHMSMHITSDASN
VYLENTWFWTADHDLDNADSTQISIYTGRGLLVEGENIWLYGTAVEHHSLYQYQFSGAKN
VVAGFIQTETPYYQPDPDAASSPYPTNTTLNDPDYSTICSSTSGNCDALGLRILDSDTVF
IYGAGLYSFFDSYSTTCSDDPGPEDCQSNIFSVEGTTSDLWVYTLSTVGTTNMVTVNGSA
LAPYRDNIATYADTIAYFTL

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	52	799	1.6e-280	0.9905405405405405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.03e-84	82	305	1	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.10e-10	433	546	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
314993	End_N_terminal	0.001	441	482	1	41	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.
227721	Pgu1	0.003	84	135	84	125	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK46226.1|GH55	0.0	12	799	12	816
CAP97426.1|GH55	0.0	12	799	12	815
QKX54382.1|GH55	0.0	44	799	60	805
BCR82778.1|GH55	0.0	58	800	45	782
QGA16171.1|GH55	0.0	58	799	57	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	8.66e-220	57	798	4	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	3.96e-207	59	799	26	756	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	3.26e-06	434	490	75	139	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	5.25e-281	59	799	48	785	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	2.54e-201	57	798	41	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	3.16e-54	98	772	71	730	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999671	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_13848-t33_1-p1.