CAZyme Information: ASPZODRAFT_137356-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_137356-t33_1-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444		49664.74	4.0846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878361:65115-66449(-)

Full Sequence      

MEILFFIGLASAAVTVTKTSQGPTGYEVTISYQNASVDSVIISSLPHLTDQYSTSFWSYA
NFDLAEYKPGDFQRDPQVGSYYPMEQTSPGEFTWTRPFPSGTYQYSFLLNCANASLCNTT
TGQEITDPTNPPFETVAGSELVSSFQVPYDPEFQYYPDLPLNQDYALPYGNNASKGRIEI
GTYPSPGSISPSDGIHDYVVYLPAGYDDDASNSSTVYPLLYLSHGGNGAAADWQNQGYIS
NLLDRLIGEGHLEPTVVVMPTWYGILPNTTNPQALEQRNYPTPPVIAELYSRYLFPYIED
NYRVSNESSRRAFAGLSQGAFVTYEFYTAYTSYFGYFGFLSGAAATNSENEAPPLSEYVN
ASMAAANPDLLDRGIFVSYGQYDVLYTDARRMQEALDALNVTYVSRFIPWGYHFWNTWQD
AFWHFGRAALWQPLPFTRYTGYGQ

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_137356-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	197	424	2.1e-37	0.920704845814978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225256	Fes	4.30e-13	199	434	85	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
225375	YbbA	0.005	200	343	27	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
199889	E_set_AMPKbeta_like_N	0.006	82	132	27	66	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL51025.1|CBM48|CE0	5.18e-20	69	430	320	642
QII47158.1|CBM48|CE0|CE6	1.17e-19	78	430	570	881
UAB85068.1|CBM48|CE0|CE6	5.02e-19	74	425	578	888
UPK72241.1|CBM48|CE1	5.37e-19	78	421	330	643
QDV29582.1|CE0	2.36e-18	200	433	67	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.56e-19	78	421	64	376	Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	1.25e-17	79	430	43	343	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.26e-17	79	430	43	343	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZN_A	1.16e-14	200	419	150	374	Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1GKL_A	3.71e-12	176	436	39	285	Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D5EXZ4|AXFA_PRER2	3.67e-12	82	325	358	571	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
sp|D5EY13|XYFA_PRER2	1.13e-10	158	375	480	688	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
sp|P51584|XYNY_ACETH	3.06e-10	176	436	827	1073	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
sp|P31471|YIEL_ECOLI	8.32e-10	76	422	68	380	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000378	0.999598	CS pos: 12-13. Pr: 0.8466

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_137356-t33_1-p1.