CAZyme Information: ASPZODRAFT_132347-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_132347-t33_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948	KV878341|CGC4	106750.73	4.7870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878341:1415316-1418358(-)

Full Sequence      

MDSLVSFEFSPGRVRLDGAPIVVDDGDFTGIHIAASCLAKDFELVTGSRPRNIRYEAGVT
DLNATGDDVVIIAGSLASPLLQRLIQSSRLTVGEIEERWESFLITVVHDPLPGIDAAVVI
AGSDKRGAIYGIYTLSEWIGVSPWYWWADVCPIQRKTIFISPGIESDGPPSVKYRGIFIN
DEAPALTSWLHEKIGPVFDAKFYERVFELLLRLKANFLWPAMWAGASFFTDDPRNQIVAE
DWGIVISTSHHEPMQRAMGEWFQSHPHKESWSWTKNKAPVQQYMREGVERAKPFESYLTL
GMRGGSDEAMEVDNPRAVLEEILAFQQGVIDDVYDEKPKQLLALYKEVQEYFDDGLVVPD
DVTLLFADDNFGTLRRLPVGKEMDRRGGAGIYYHLEYVGHPRSYKWINSNHCGRIWQQLQ
LAHSRRADQIWVFNVGDIKPQEMPLSMALRLAWKIDSISADDFSSFFLDFCKTNVFPVAE
EAADLLGEYDRLLAMRKHEHIEADTFSLLNYDEAEDILLGWEDKLSTAEELYATLDSEHR
PAFFQLVLHPIKASTIYMQLRFHQARNRLYGSQRRNETNAVAQHVLALFDADYDLAEEYH
ALLDGKWNHLLRQPHYGYSATTWHAPSRDLVDGLCFVQLRQPSNPIMGNMGVAVEGHPGV
RPGLVNEESDRTHPSQRDLVVGVTLPPFDTYGPQTRWFELFRRGPACLNWSLVTRCPWIA
LSPSSGRLDSTCNDVRVEVTIDQTAVPLYFNETVEVAVFSDRGDYEVMHLPVSARHIPGP
FTGFVESDRCVAITTINAETGNALSLSFLGRTGAVAVPFDSTDTLLEYSVYTFTERSTAE
MLLYFSMALDTDPTNPLAFHVWFDDDSYGETRLIEAPATAGDLPEGWSTAVQDCVWRRSV
MLGHVAPGSHTIKIRMMGAGMALEKIVLDLGGVRESYLGPPARYVSIH

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	19	622	4.6e-218	0.8177905308464849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	0.0	168	500	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	8.02e-47	783	942	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65957.1|GH115	0.0	10	944	12	962
QMW48785.1|GH115	0.0	10	944	12	962
QMW36729.1|GH115	0.0	10	944	12	962
QRD92204.1|GH115	0.0	10	944	12	962
BCS23930.1|GH115	0.0	10	941	12	962

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.15e-193	5	940	6	930	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	1.48e-142	20	624	54	651	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.28e-140	8	630	11	644	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.20e-139	8	630	10	643	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	6.26e-105	18	618	19	642	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

ASPZODRAFT_132347-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_132347-t33_1-p1.