CAZyme Information: ASPZODRAFT_129029-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_129029-t33_1-p1
• CAZy Family: CBM48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	KV878337|CGC2	72866.13	4.2358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878337:2164015-2165985(-)

Full Sequence      

MKLFGALALAGLLSYGAEAASSRRFGYTNTTFYLEGKPFQIVGGQMDPQRVPYQYWRERL
NKARSMGLNTIFSYVYWNLLEPEPGHWATDEPNNNIAEYFRIAQEEGLNIVLRPGPYICG
EREWGGFPWWLSEIPGLEVRTNNTLFLYYAGLYLDRLAEEIRPLQATKGGPILMIQVENE
YGSYGSNHNYTARLRDMLRENFDSVLYTNDGGVNWTLAGGSVPGVLAETDGTPESGFEAR
DEYITNPTELGPLLDGEYYTLAPDQWGSNATHNDPDDDPADLNGFVNDLEFVLNGSNSIS
FYMFHGGTNYGFGNGGIWRDANYLAAFTTSYDYGAPLDESGRTTELYYILRETIEKYFPN
GSIPAVVPDVPRSSIDEFALEPVASVFDTLLPEPVQSEHPVSMESLGQAYGYVLYETTAQ
QAYTGILQVGDRPRDRVIVYVNGVKQGVVDAIYETVGEVKVTLQAGDKLQLLVENLGRVD
YWSLGSGTFNALLEPHKGIVGNVTVGGEIVTKWNVYSLPFDQVPIVNSGSSSSNNNNTTT
IETLPQTPVVYSGRFQLADRDRSSKTDLELDTFLAIPRGTKGVVWVNGFNLGRYWIIGPQ
QSLYLPGVHLRREGWNEVVVLELEPTEQVMEAEGQSERVWANHADPDAPGLPSLGS

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	32	355	1.4e-86	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	2.50e-96	31	354	1	315	Glycosyl hydrolases family 35.
166698	PLN03059	2.83e-39	27	345	32	329	beta-galactosidase; Provisional
224786	GanA	1.62e-35	25	628	1	595	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	1.74e-05	48	205	4	165	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI19525.1|GH35	2.38e-236	6	649	7	636
QKX60376.1|GH35	3.09e-225	13	649	23	650
QLI69147.1|GH35	2.39e-220	10	647	15	641
ATY64919.1|GH35	8.74e-214	3	603	4	588
QLI64958.1|GH35	6.78e-191	25	649	26	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	1.97e-112	31	628	23	583	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	3.85e-105	20	624	4	599	Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	7.15e-105	20	624	28	623	Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.98e-104	20	624	28	623	Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	1.71e-98	16	624	9	607	Chain A, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P16278|BGAL_HUMAN	9.24e-105	16	624	23	622	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
sp|P48982|BGAL_XANMN	1.73e-104	6	605	12	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
sp|Q60HF6|BGAL_MACFA	2.90e-104	16	624	23	622	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
sp|Q5R7P4|BGAL_PONAB	3.84e-103	16	624	23	622	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
sp|Q58D55|BGAL_BOVIN	6.16e-102	16	624	22	621	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999710	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_129029-t33_1-p1.