CAZyme Information: ASPZODRAFT_127289-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_127289-t33_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59340.79	5.4171

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:2064814-2066595(+)

Full Sequence      

MTPLTSLVTALAIAISVGNRGAYGKTQEVLLDACPDYTSYSAVSHAPYSGGPLNLPFQRP
ATECRTFSSSAVEQVIEDVTSRMVDKDLAQLFRNAFPNTLDTTVRWHTNGSTPNTTNKKH
KKAKLNGSQWEGAHSFIVTGDINAEWLRDSTNQLAGYQALAKKDKSLYTLILGAINTQAE
YVIQSPYCNAFQPPPPSGINPSSNGVKDTVHPAYESSFVFECKYELDSLAHFLALGTQFY
ENTDSVEFLTNRWYKALDTLLHVLDAQSTPTFDSNQQFVVNEYTFQRETTLGTETLSLKG
VGNPLNRGTGLIRSAFRPSDDATILGFFIPANAMMAVQLQKTAIVIEAAGGDASLASQLR
QRGQDLEKAVWEHGVVDHPKFGKVFAFEVDGYGSQIMMDDANVPSLLSLPLLGFLDQNDP
TYQNTRKMILDPTGNPYYLSGSAFHGIGGPHIGFQYAWPMSLLVQAQTSNSETEIMDSIN
LVRDSSLLGLVHESINVNNIKDYTRPWFAWANSVFAQTILKIAAEKPWLIFGPGASPYTL

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_127289-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	85	520	1.9e-161	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	85	520	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.54e-151	64	527	2	427	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS09358.1|GH125	1.73e-294	4	540	1	535
BCR96870.1|GH125	1.73e-294	4	540	1	535
CAK38960.1|GH125	3.49e-294	4	540	1	535
QRD90853.1|GH125	3.44e-292	6	540	7	536
QMW43832.1|GH125	3.44e-292	6	540	7	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	5.54e-97	54	525	38	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.92e-96	54	525	18	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	2.47e-94	59	525	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	3.23e-78	72	526	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	7.17e-78	72	526	12	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.09e-180	22	530	15	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.326417	0.673553	CS pos: 24-25. Pr: 0.4189

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_127289-t33_1-p1.