CAZyme Information: ASPZODRAFT_127128-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_127128-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	KV878336|CGC7	48690.65	7.4680

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:1708435-1709751(+)

Full Sequence      

MKPQFLSLLARCCFIAGIALQGSHACRFRRPKYPSKPVQPVQPECDCYVVSGPEPGYFQN
YQFWDFRAVSFDQKLANEESGLLPARADQGDDAIGGSADGFKGKTILLSETPFAEDWKIQ
KWKRNPSDLAPVHMVHSNDNVFIARNPSPGRDNPNSTYLVLRTTRFENFTSTAEIESRLQ
NVFRASIRVHFKILSDDEPSSILPSERGNVLTATSQRNIRPSSNQAVPKASSPPGGVCAG
IFTYHSSKCESDIEILTSDPHSRVHYANQPDYDPVTDTMIPGASTIMDVPVPWTSWATHR
LDWTQTTSRWFVDEQLQDTKTYRVPEKPSMVVLNLWSDGGSWSGDMVHGTSVHMAIEWIE
LAYNVSTQKDHIPDDRQTLPPKHAGRGSIFHAVGLRRDGQEESPAENSSVAKGKMCRNPC
KIDGLGKRGGPRGAAFKS

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_127128-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	115	361	2.9e-79	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	7.16e-41	109	360	5	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.10e-04	236	359	82	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	0.003	292	359	100	167	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK40468.1|GH16_22	4.11e-109	34	425	29	449
CAP95204.1|GH16_22	4.97e-106	34	425	69	489
QSS75565.1|GH16_22	4.49e-99	45	431	42	440
QSS53837.1|GH16_22	8.97e-99	45	431	42	440
QSS58825.1|GH16_22	1.01e-97	45	431	42	440

PDB Hits     

ASPZODRAFT_127128-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPZODRAFT_127128-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000724	0.999263	CS pos: 25-26. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_127128-t33_1-p1.