CAZyme Information: ASPZODRAFT_126800-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_126800-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39900.44	8.4103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:1044170-1045210(-)

Full Sequence      

MSIPIQRRIQILTGLAVVVWVLIIILSPRVDSSGASLSISRHFRGQKKPRYRRDVAVATY
FSGETATSNDIQEDNYFIATRTLTYQLRHSPQTRLDPSIAFIILVTPDVSQRKRNQLVRE
GAIVIEVDKVETNLTVGEPRWRGCWTKLRLFDPEILPFERVLFMDSDTVLTRSVDGVFND
PAAKLHRTLNLTGQSQEDEAALPGKYLFAGKPEAGTYSHSYPPDMSGDYLNAGFFVYSPS
HAILQHYLSLLELQGRFSPDMPEQNLLNYAHRRDGNMPWQKLHYSWNMNFVTPEDLRNQP
ASLHVKYWDKSLQQEVIDYALRCRWEMEGFWIGVNQRAKKIDLFNH

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_126800-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	74	306	9.2e-27	0.8287937743190662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.02e-27	74	289	10	183	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	5.89e-21	46	308	52	336	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133037	GT8_A4GalT_like	1.43e-08	74	288	9	209	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	7.30e-05	74	288	8	217	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
132996	Glyco_transf_8	1.21e-04	138	268	75	194	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR55167.1|GT8	9.01e-81	26	333	38	346
SMR57542.1|GT8	5.09e-80	26	333	38	346
SMY25981.1|GT8	7.19e-80	26	333	38	346
SMQ52339.1|GT8	1.11e-78	26	333	38	345
UJO16919.1|GT8	4.24e-74	55	333	60	348

PDB Hits     

ASPZODRAFT_126800-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	1.09e-20	62	308	69	336	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|O43062|YGT9_SCHPO	2.89e-20	72	309	87	346	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q9FXB2|GOLS2_ARATH	9.63e-06	102	268	55	220	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.523206	0.476804

TMHMM  Annotations     

Start	End
9	28