CAZyme Information: ASPZODRAFT_126671-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_126671-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		79100.32	4.7657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:806347-808512(-)

Full Sequence      

MTGCQSVGIAATPKHFVANDAENLRTTLSTEVDEQTLRELYLLPFQLIMKLADPWCFMTS
YNRVNGTYVSDDPRLVQGVLRHEWGFRGLVVSDWMGTYSTAEGMNAGVDLEMPGPPKWRG
ERLLQAVAEGAVSQKTIDESARRVLDLARRLRRWEEHPEEEPPERALEDPERDEFIRDAA
AEGIVLLQNRDAVLPLTLAAGETVALIGHHARIVTLGGGGSARVDALHAVNLVDGFAQLG
VQTTVSPGVPVFGAVPHADAGLLFQTGGGQGEQPVKVEWFNGSVVGENLVHTETRPVPEY
MIKEQWPAYLAREYCTRMTVDLQPESSGEHLFSVVSTGRAVCSINGRVVFERAQETALKP
ESFYFFKSKLERRFTFAMQAGVRYTLTLESWATDPEILAAKPLFGRMFQGSALRFHEAID
VPGAIEAAASTARACAAAVVCVGTTNEIESEGFDRDTMDLTDEQYALIRAVAAQNPRTVV
VNFSGAPVGLTQVLDVVPAVVQAWFPGQECGHAVARVLTGAVNPSGRLPLSWPRQVEDNP
SFGNFPADEETLLIKYEEGLDVGYRFYDREETPTPLFPFGFGLSYTSFAVSNARVVASVQ
QQQAVLSSRSDTVEVKCDVQNTGSRTGKVVVQFYVGMPATTIGRKRPIKELKEFVKVELA
AGQSQTISVVLDRYAVSLYDADRSCWRANPGRYTVYVGQSSVDLSSQTDFTVSEPLEWTG
I

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_126671-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	113	2.6e-32	0.5370370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.94e-56	9	708	203	761	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	7.79e-43	443	564	99	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.09e-38	3	231	155	384	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
405066	Fn3-like	5.08e-23	630	701	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
395747	Glyco_hydro_3	8.35e-23	1	147	157	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95967.1|GH3	3.69e-301	3	721	137	851
BCS30061.1|GH3	4.53e-297	7	721	1	712
QKD60297.1|GH3	4.17e-263	3	721	138	834
CCT75026.1|GH3	6.47e-259	3	721	135	831
CZS81178.1|GH3	2.88e-258	3	721	138	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.34e-107	3	721	135	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.97e-104	3	721	135	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.65e-73	3	704	141	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.47e-70	1	706	140	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.26e-66	3	712	185	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	1.06e-123	3	721	142	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q5BFG8|BGLB_EMENI	2.48e-123	3	709	140	835	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.91e-122	1	704	130	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	7.20e-120	3	721	135	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.86e-120	3	721	135	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_126671-t33_1-p1.