CAZyme Information: ASPZODRAFT_126651-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_126651-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41553.28	5.8360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:768098-769192(+)

Full Sequence      

MTPPSKTIHSTIDQLINNLVNIRDESGEFLAPTADGRIIDTKSWASWEWTHGIGLYGLWK
YYELTGKKELLSIIEEWFAARFAEGGTTKNINTMAAFLTLAYVYEETRNPIYRPWLESWA
DWAMHDLPRTKYGGMQHLTYHDENVEQLWDDTLVMTVLPLAKIGLLLHRGEYVEEAKRQF
LVHIKYLFDSRTGLWYHGWTFEEGGHNFAGARWARGNSWITIAIPEMLDLLDLDGHAAFR
VHLVDTLNAQCEALQRLQADSGAWHTLLDHTDSYLEASATAGFAYGILKAVRRRYLDARF
RPVAEKAVLAVLGFVDEHGELQGTSFGTPMGHDLDFYKKIPLTAMPYGQAMAIMALGEYL
RTYI

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_126651-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	361	2.1e-107	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.54e-113	14	363	3	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.88e-103	21	363	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBO93662.1|GH105	1.96e-213	3	361	6	364
CAP80991.1|GH105	1.96e-213	3	361	6	364
QQK40818.1|GH105	3.60e-209	8	361	11	364
BCR92923.1|GH105	1.25e-206	1	364	1	364
BAE56723.1|GH105	2.71e-206	2	364	6	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.20e-165	8	363	26	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.57e-163	5	364	5	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	2.21e-158	8	363	27	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	2.66e-25	169	361	222	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.60e-51	46	362	28	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.34e-10	140	360	189	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.63e-07	169	312	15	166	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.63e-07	169	312	15	166	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_126651-t33_1-p1.