CAZyme Information: ASPZODRAFT_11580-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_11580-t33_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		62518.63	5.6550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:766055-767874(+)

Full Sequence      

MSSQWDFIIVGSGPAGCAVAAGLAHTSKKPKVLLLEAGGRNQEDSLRVDGQRWTTFHNPE
LNWGYKTVPQQHCNNRELEYHRGRMLGGSSAINFSAYTRGPREDYDRWAEKVGDETFRWE
QMLQRFKRLESFHGEFQHEEYYKYASPSPSDHGSHGPLHVGYAREWENDLPLIMDGLIAA
GLERNLDLNSGNPLGIGLASNTAYQGRRSTAADLLLDAPDNLTVLAQAAVQRVILEGKKV
IGVESGEHRYYAAKEVVLCAGTLDNPRILMHSGIGPRDELARFRIPVRHDLPAVGKGLRD
HPAFAITLERKAGTNDRNAFFKNPDAMAEAQEQWDMDRTGPWARHSCQLVMGFLKMDDRL
LGSSEFASLPADVQEFLQRPTVPHWELIANAPLPQFAPGLITDFGSVTLLAIFMNEQSVG
EVRLQSSDPNVPLLFDPHFLEHPYDRKGCVDMVRELLALVRHEAIAKDTLSTLVGPASDS
EADILEFCRATATSVWHMTGTVVMGAAGDPKAGVDSHFRVLGLEALRVADMSVVPILPNN
HTQSTAYVTGMTCADVMIEEYGLDV

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_11580-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	559	1.3e-149	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.47e-95	1	555	4	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.10e-90	1	557	2	531	choline dehydrogenase; Validated
274888	Rv0697	3.48e-55	6	550	2	479	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
215420	PLN02785	4.34e-38	3	550	54	569	Protein HOTHEAD
366272	GMC_oxred_N	1.86e-35	73	303	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46531.1|AA3_2	1.14e-241	5	564	8	566
BCR99292.1|AA3_2	4.63e-241	5	565	8	567
BCS11595.1|AA3_2	4.63e-241	5	565	8	567
EAA62931.1|AA3_2	1.73e-234	5	564	7	569
AEO58638.1|AA3_2	2.47e-219	1	564	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	3.97e-63	4	561	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	3.31e-52	3	557	1	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	6.22e-52	4	557	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3NNE_A	9.85e-48	4	557	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	9.85e-48	4	557	13	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	3.23e-67	2	557	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0R4L2|PDH3_LEUMG	5.22e-64	4	547	40	585	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L243|PDH2_LEUMG	3.78e-63	4	561	40	599	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	1.19e-62	2	557	4	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	2.04e-62	4	561	40	601	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999278	0.000771

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_11580-t33_1-p1.