CAZyme Information: ASPZODRAFT_104974-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_104974-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428	KV878358|CGC3	46406.42	4.9265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878358:127692-129030(+)

Full Sequence      

MTPIVVIACPTHPGHTNPLLPHAAYLTKQGFEVHFIGGEAFAPGIEQTGASFHPTEDFPL
PLELFDLPPTPERFMSELKQVFVDTTPARMDALKRLLESLRTAHPDRDVVILQELMYMGV
WPYLQGAPLPAGYTTFPPVITISTVPMVISSIDTAPFGPGLPPDASPEGRARHAAMYAAG
KPLMDDFLQYTNSTYATLGATEPVTRAIFDHWSLGTGRFLQPCSPSLEYPRSDLSPAVTF
IGALPRKDLSSELPEGLIPEGNTRKIVFVTQGTISLDYTALLVPTIEALADREDLLVIGV
LGVKGASLDIKLPANARVLDYLAYDAILPCTDVFVSNGGYGGFLHGVMHAVPMVLAGEGQ
DKAEVATRGEWAGIAVDLKTNRPSVEQIKQSVDGVLKDSQMKTRCLAIKKENQDLDCFKQ
VEKAIMQA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	94	426	1.9e-30	0.7827225130890052

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	1.49e-37	1	427	1	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	2.30e-28	5	411	3	387	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	2.40e-19	10	411	4	372	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39187.1|GT1	3.33e-162	3	427	17	454
BCS13313.1|GT1	1.22e-154	3	427	17	453
BCS01597.1|GT1	1.22e-154	3	427	17	453
UPK94024.1|GT1	2.61e-117	3	426	26	459
UQC81531.1|GT1	1.04e-111	14	425	132	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNT_A	8.93e-08	224	416	239	419	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
6J31_A	1.44e-07	218	411	191	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.45e-07	218	411	194	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
2YJN_A	8.16e-06	311	398	316	403	Structure of the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.43e-85	4	426	21	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.17e-69	14	425	19	431	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	1.55e-64	4	425	8	427	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	3.89e-49	5	411	5	403	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|O05496|YDHE_BACSU	2.43e-08	1	413	1	371	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_104974-t33_1-p1.