CAZyme Information: ASPZODRAFT_102882-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_102882-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		58114.08	7.6219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878351:113489-115083(-)

Full Sequence      

MYDIRALPPDRDALGGQRYQTALHCLSLAAIWICRVYFCFRLLFLVCYESTWWMWVTLAV
EGIFAYTPYLEQCLVASTKAPPREKLRIHGETVPRVDILLPCCGEDEEIILQTVTAACSI
DYPRSSFRVRVLDDGESKILCERVKALREEKYPHLSYHTRGKQSGKVFAKAGNINFALSE
LERGEKDDQPVFCAILDADSVPCPDFLRATIPHLLRDESVSLVTTRQYFSNLPDGDRLSQ
SRSHFYTVINSALDRAGQAIDSGSGAVFRRQAILEAGGYPTFSFSEDWQLSLVLRGHDRR
IVQVDEQLQHGLVPSSLRGHIAQRNRWMIGHSQQVFALKEGHIPRKIQWMIVRDGLFIVW
GLLSSFLGFVLLPVLAVSASLSLPFPPWMSALSLLYVAVQWGYEHLQAACAGCAPFASWE
NRWMAGMNLLAIARFHLSSHRPKSFVTGSNNHSEEDSWSQWLFGHGMIYNVAILVAILSA
LVIYRVDNWVLLHLCYLTIKNHWVPLAYLLRQ

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_102882-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	194	392	9e-21	0.9289340101522843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	2.32e-83	94	334	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	2.85e-38	40	438	11	384	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133059	CESA_CaSu_A2	4.37e-25	94	330	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133045	CESA_like	8.90e-24	98	287	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
236918	bcsA	6.60e-22	94	333	260	490	cellulose synthase catalytic subunit; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81189.1|GT2	1.62e-162	3	510	8	554
BCS12365.1|GT2	3.27e-156	1	511	6	554
BCS00600.1|GT2	3.27e-156	1	511	6	554
UDD54668.1|GT2	3.23e-155	3	510	8	554
QGA14290.1|GT2	9.54e-155	2	512	7	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	3.84e-26	88	335	122	379	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.24e-26	88	335	134	391	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.24e-26	88	335	135	392	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.33e-19	94	338	273	507	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	8.38e-22	94	333	153	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	9.25e-21	94	349	146	391	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	9.25e-21	94	349	146	391	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|P58931|BCSA_PSEFS	1.48e-20	86	349	151	404	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q93IN2|BCSA_SALTY	7.01e-20	94	338	273	507	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999942	0.000049

TMHMM  Annotations     

Start	End
21	43
53	70
355	377
461	483