CAZyme Information: ASPZODRAFT_100364-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_100364-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	KV878346|CGC8	34663.68	4.8359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878346:828254-829177(+)

Full Sequence      

MAPLTRTLLICITVVLLYKVLIRYPIYTADSPIESTIPPVNVFPLPPSEAWETLRGQRFP
AKLWQKSSSEISERNQERIRSWRLHTPYLRHELLTDASADEYVRERYGAYPELVEIYLSL
QVPILKADVLRQLILYADGGIWSDLDVTCHAAIERWIPEPYRNATNVLVGIEFDGEQFAS
WTVMAKPRSSHFAAVIRYIVAGLQESAAQYQTSISGLTMQTISDVVNVTGPQAMTVAILE
NLRLEMGEPVGFADLVNVTRPMLLQDVLVLPDAAFAASQAEWPKDRGEYLVEHHYEGSWK
NEGGGYL

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_100364-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	158	9.9e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.25e-20	59	187	82	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.00e-11	72	162	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK40626.1|GT32	3.20e-106	60	305	94	340
CAP80736.1|GT32	1.29e-105	60	305	94	340
BCS30122.1|GT32	3.58e-88	59	305	111	362
EAA62114.1|GT32	3.91e-81	59	305	112	363
CAK40793.1|GT32	3.30e-71	60	305	104	349

PDB Hits     

ASPZODRAFT_100364-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.15e-27	60	302	143	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.10e-19	58	301	129	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.78e-18	59	303	99	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.22e-09	60	268	97	352	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.966956	0.033064

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_100364-t33_1-p1.