CAZyme Information: ASPWEDRAFT_99219-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_99219-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	KV878209|CGC24	40903.41	5.2270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:4233693-4234840(-)

Full Sequence      

MLTFRKSLIAACCLIAFILILRSSHSSTPSNSPPIAPEGAIYNNDNGETVAEQPQGQTQQ
QTLKPLEPAPNAPLRERLRYHFPYDLEKKFPAYIWQTWKYAPSSMWFDSELRVAEASWTD
LHPGFVHQVITDDTQRHLVKYLFASLPDIFEAYEAMPLAVLKADFFRYLILLARGGIYSD
IDTSALKPASDWLPSQLDLSTVGFVVGIEADPDRPDWSDWYSRRIQFCQWTIQSKPGHPI
LRDIVAHITEEALRMKKKGILAKGKMDKTIVEFTGPAAWTDAVFRYFNNPDYFNIEPGTT
NVTYEDFTNQVEHKKVGDVVVLPITSFSPGVQQMGAQDYDDPMAFVKHDFDGSWKTDPSL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	195	4.4e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.56e-43	74	357	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.50e-16	117	196	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84625.1|GT32	8.04e-204	1	360	1	363
CBV36935.1|GT32	1.40e-203	1	360	1	359
UDD58159.1|GT32	2.30e-203	1	360	1	363
BCS07268.1|GT32	1.16e-198	1	360	1	362
BCR94678.1|GT32	1.16e-198	1	360	1	362

PDB Hits     

ASPWEDRAFT_99219-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.66e-95	74	357	83	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.08e-79	80	357	132	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.00e-70	70	360	110	393	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.27e-69	74	357	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	6.86e-06	91	193	3	101	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.575466	0.424529

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_99219-t33_1-p1.