CAZyme Information: ASPWEDRAFT_81873-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_81873-t33_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		34529.69	8.8452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:87980-88873(+)

Full Sequence      

PISSITFLVLLFLFSSFCQSLAEFSSGQKANSLLLHHFSPAYVKALNESIVAGKPINFPD
QQSNHTIPRIIHRTYKTTDIPKDWQGAYDSCRKVNPTYKQFFWTDEGAREFIQREFAWFL
PTYDSYSYDIQRVDALRYFLLWHYGGIYIDMDIECRRPLDPLLDFPALLPKTWPYGVSND
FMASAPNHPFIIKVALSLQEHNRHYLSKYITVFFTTGPMFLSNILSQWLRMTRERSNGNL
KLSHIVGILPSMMYDTTSYSFLGHRKGSSWHGNDVAVMRYTYQHLWGLLLGVAGLIIL

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_81873-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	163	2.1e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.24e-53	66	285	81	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.76e-22	81	169	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	8.46e-134	10	295	35	323
BAE56144.1|GT32	8.46e-134	10	295	35	323
QMW37845.1|GT32	8.46e-134	10	295	35	323
QMW25762.1|GT32	8.46e-134	10	295	35	323
UCK58225.1|GT32	8.90e-128	37	295	38	299

PDB Hits     

ASPWEDRAFT_81873-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.18e-69	67	285	55	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.33e-64	67	285	62	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.12e-63	67	284	57	268	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.17e-60	43	285	58	296	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.61e-58	67	277	64	268	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999749	CS pos: 22-23. Pr: 0.8525

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_81873-t33_1-p1.