CAZyme Information: ASPWEDRAFT_737628-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_737628-t33_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		94623.18	6.2347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:973495-976173(+)

Full Sequence      

MPQKEFCPKGYQEIPEKHQNSPDVHLRSSSSSKQQFDFSFETIRQNLFRVVFSSQDHPIP
PYPSVSKPETNLRDVQISADSSSSAKTIQVGDVTASVEWAQTPVVSLSWTGEEKPLHRDL
PLRSYVADATGIAHYTEHDRDALHVGLGEKRAPMDLSGRNFLLSATDCFGYDVYNSDPLY
KHLPLLVKATANGCVAIFSTTHGRGSWSVGSEIDGLWGHFKVYRQDHGGLEQYLIVGKTI
KDVVRSYAELVGFPILVPRWAYGYISGGYKYTMIDEPPANQGLLEFADKLKEHGIPCSAH
QMSSGYSIAEKEPKVRNVFTWNKHRFPNPEEWIAKYHAHGIRLLTNIKPFLLGSHPDFKR
LVDAGAFFKDEDTNEPGYMRLWSAGGATGGDGCHIDFTSSFGFKWWYNGVQSLKRAGIDA
MWNDNNEYTLPDDDWKLALDEPAVAKAAQKQVTNSVGLWGRAIHTELMGKSSYDALLDIE
PQHRPFVLTRSATAGTMRYAGSTWSGDNVTSWDNMKGANALSLNAGMSLLQCSGHDIGGF
EGPQPSPELLLRWIQLGIHSPRFAINCFKTARNSSSGDVIEPWMYPEITPLVRDTIKRRY
EILPYIYSLGLESHLDASPPQRWIGWGFESDPEVWTQTLKSGEEQFWFGDTILVGGVYQP
GVNVARFYLPRKAANDQFDYGYVNMNAPYTYLASGQWVEIPSEWKASIPLVARIGGAIPV
GKSVHTKVPGDDTAASLAVQEDDDYRGVEIFPPQGGSHGRVFSTTWYEDDGISLHPGISR
YTISYSSTAEKVIVEFARDEQGGFVPAWKDLDIILHNGDERRVVSEVGKSVEYKGKDSRG
RVVYTLKA

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_737628-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	233	718	1.4e-99	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	1.36e-155	252	596	1	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
395838	Glyco_hydro_31	1.46e-115	233	718	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	5.00e-109	132	835	143	771	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	5.11e-67	252	615	1	337	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269889	GH31_GANC_GANAB_alpha	1.84e-54	252	773	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10211.1|GH31	0.0	1	847	1	846
BCR97753.1|GH31	0.0	1	847	1	846
QRD85402.1|GH31	0.0	1	847	1	846
QMW29116.1|GH31	0.0	1	847	1	846
BAE58852.1|GH31	0.0	1	847	1	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJW_A	2.13e-46	126	814	47	661	Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2G3M_A	7.23e-45	145	801	65	669	Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3N_A Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus]
5IEF_A	1.27e-43	158	832	242	880	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.28e-43	158	832	242	880	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IED_A	1.36e-43	158	832	264	902	Murine endoplasmic reticulum alpha-glucosidase II with castanospermine [Mus musculus],5IEE_A Murine endoplasmic reticulum alpha-glucosidase II with 1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	6.93e-54	146	825	151	765	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q14697|GANAB_HUMAN	3.06e-48	158	832	274	912	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q4R4N7|GANAB_MACFA	1.74e-47	158	832	274	912	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q9FN05|PSL5_ARATH	5.04e-47	128	774	222	821	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|P79403|GANAB_PIG	9.87e-47	158	832	274	912	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_737628-t33_1-p1.