CAZyme Information: ASPWEDRAFT_73120-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_73120-t33_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	KV878218|CGC6	106378.15	7.5982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:48317-51574(+)

Full Sequence      

MNRNNHDCLPNTLQKDTNIHDEIDDPPPAYSEIGTIAITNEGLQTQAQVTDDGRVDVVVE
DASGHLNQIFTPALQQQVDAIHNANTGQKTARVTGCPVRLSIVIHAVGSLQDIRPLVTTG
RVLKEQYGHRVRLATHSTFLDLVESNGLEFFNIGGDPGDAMGSLTNSPTLLPSMANYGKK
RNEIAAIVDGCWRSCIDNGHGVGRMPFNEDTSIDPFVADAIIANPFSFAHIHCAEKLEIP
LHIMSTIPWSPTAAFPHPLANIRSSNTSESTSNCVSYSLLEMLTWQGIGDVINQFREKTL
NLEPLSKVPATGLLSRLQVPHTYCWSPSLLPKPNDWGQHISVAGFVPPGNNLSYMPDPDL
AAFLAAGSLPVYIDVGSVANDLGIILDAVRKTGQRALISKSHDRLSNVSKQPDIFFVDSC
PPDWLFQRVSCAVHSGQLELVTASIVSGKPTVIVSSFGDQRFWGGMVANAGVGPQPIPQK
DLTADKLVEAIRYALSPRIRQRAGEMGYAIREEDGCRNAVDSFHEHLGMDDMRCSILPSE
KAVWKVKRTKQRLSAVAATLLAHEGLLDLGDLKPLRLRKYQTADGPLDPISGGTLAILGS
VSKLSVAIAGMPIDVVKSVLTSERSISHYQSLLTQKLQNSRRPALTDRRASSTSDIQGKG
KESTRRNSSGKAFMYGFYKEMSGKDAFAARKSSITSKDDPQHDQQPSNSILSDAAKGTGK
SMGRIVGLSLKTPLDFTAGIAKGFRNAPRLYGDDTVRQTNKITGFQSGVKVAGKELGLGF
YDGITGIFTQPVRGAKQGGVSGFVKGIGKGLGGAVLKPGAGIAIFGIPAYSFQGVYEEVQ
KSLGNNVSSYIFTTHYLHGTQAMEQLDSDERAQIIRSWHDRERQAPDLRDRWNAVQQRRR
GTNNTSSSRSSTFQKDPSVGSTWNNGEGAGPSVFGMETPWDNPILELEASPENAVHELSS
SPRQAVFEMEAPVESGKKSVKV

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	212	526	1.8e-41	0.7591623036649214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.96e-58	102	526	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.46e-21	102	525	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
227376	MRS6	3.10e-07	705	823	2288	2399	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD33816.1|GT1	8.49e-262	20	884	75	1009
ATZ49754.1|GT1	1.69e-261	20	884	75	1009
APA09867.1|GT1	5.52e-254	20	891	75	1018
SMQ49737.1|GT1	6.68e-251	6	879	48	971
SMR51663.1|GT1	7.43e-250	6	879	48	972

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.59e-47	107	527	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	6.78e-47	107	527	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	5.63e-18	234	513	113	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.15e-17	289	513	150	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	7.31e-14	358	521	227	393	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.47e-88	99	527	155	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.30e-87	100	527	193	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	2.63e-51	99	573	696	1174	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	2.64e-51	97	527	1160	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q6C8M8|ATG26_YARLI	7.36e-47	99	527	994	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000111

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_73120-t33_1-p1.