CAZyme Information: ASPWEDRAFT_69425-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_69425-t33_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	KV878212|CGC21	64932.73	6.2039

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:4072030-4073890(+)

Full Sequence      

MATQSKYDFIIVGGGTAGNTIAGRLAENPNVRILIVEAGISNPDEIDEITTPSKAFGLRG
SQYDWAYKSTMIKRDDYERIEKPNTRGKTLGGSSCANYFTWIPGSKPTFDDWEEFGGKDW
TWDNCVDYLRKCATYHDDEKLYPNELSKIGTGGPLQISHAELVPEMKPFRDALTQAWVSK
GESLTEDIYSGEMKGLTHCVDTIYKGQRQGSYLFLKNKPNVSVLSGAISKRLIIDPTTHT
CAGVTVINATTGTELSVYASREVIISQGVFETPKLLMLSGVGPAAELSKHGVDVLVNSPH
VGQHLLDHPIVPFVLKIKDGYGLDDHLLRTGPLNNAAVAAYQHDKTGPVGSGLLELVGFP
RIDERLQKYPEYREAKAANKGKDPFGPAGQPHFELDFVGMFSSAFQWHYPVPKEGNYMTV
IVDLLRPLSEGEVTLNGNNPLVQPNINLNFFGLDLDILAMREGVRWTYDLLTKGAGFKDI
VLNEYPWEMPLDSDEEMKKAVLDRSQTGFHPCGTARLSKNIGQGVVDSRLRVHGIKNLRI
ADASIIPVIPDCRIQNSVYMIGEKGADIIKAEHQDLYGGKNSHFASRL

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_69425-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	571	9e-149	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.82e-85	3	570	2	532	choline dehydrogenase; Validated
225186	BetA	2.26e-84	1	573	2	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.96e-41	427	564	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.13e-21	86	310	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.19e-19	5	562	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00597.1|AA3_2	0.0	1	581	4	584
UNI24682.1|AA3_2	0.0	1	586	4	590
BCS26129.1|AA3_2	0.0	1	581	1	584
QKX58151.1|AA3_2	0.0	1	581	4	584
UPK99980.1|AA3_2	0.0	1	577	4	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	5.91e-314	5	577	5	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.69e-313	5	577	5	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.84e-313	5	577	5	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.92e-71	7	572	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.47e-71	5	572	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	4.42e-59	3	570	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	5.95e-58	4	570	2	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1
sp|B0KN19|BETA_PSEPG	8.26e-58	4	570	2	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	8.42e-58	3	570	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	8.42e-58	3	570	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_69425-t33_1-p1.