CAZyme Information: ASPWEDRAFT_58732-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_58732-t33_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	KV878211|CGC21	39379.03	4.2826

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:2058858-2060203(+)

Full Sequence      

MKYTALLAAIASTAAAAVSVSGTAEGFASSVTGGGDATAVYPSTTDELVSYLGDDEARVI
VLSKTFDFTETEGTTTGTGCAPWGTASACQVAIDSNKWCENYESDAPSVSVSYDNAGTLG
ITVASDKTILGEGSKGVIKGKGLRIVSGASNIIIQNIAVTDINPKYVWGGDAITVNDADL
VWIDHVTTARIGRQHIVLGTEADNRVSITNNYINGESDYSATCDGYHYWGIYLDGSSDKV
TLKGNYIYHTSGRSPKVQGNTYLHAVNNYWYDNTGHAFEIGEGAYVLAEGNVFQDVTTPA
ESPIDGEVFTVPSTTSAEQCSSYIGRNCEVNGFGNSGTFSQSDTGVLSKFKGETVASASA
YSSVASSVSSNAGQGHL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	295	1.9e-90	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	9.27e-57	109	296	2	189	Amb_all domain.
226384	PelB	6.96e-16	121	299	97	279	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	7.87e-13	121	293	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88479.1|PL1_4	4.72e-223	1	377	1	380
AGO18310.1|PL1_4	1.18e-215	1	377	1	376
BCS20241.1|PL1_4	2.15e-212	6	377	9	380
ABF50854.1|PL1_4|4.2.2.10	9.78e-211	12	373	15	376
BCR99415.1|PL1_4	2.67e-208	1	377	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.29e-205	18	377	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.14e-203	18	377	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	5.66e-178	20	375	3	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BAU9|PELA_EMENI	1.74e-211	12	373	15	376	Pectin lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelA PE=1 SV=2
sp|A1CYC2|PELA_NEOFI	5.31e-208	1	377	1	378	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|A2R3I1|PELA_ASPNC	1.06e-205	1	377	1	379	Probable pectin lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelA PE=3 SV=1
sp|Q01172|PELA_ASPNG	1.75e-204	1	377	1	379	Pectin lyase A OS=Aspergillus niger OX=5061 GN=pelA PE=1 SV=1
sp|Q4WIS6|PELB_ASPFU	9.70e-204	1	377	1	378	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000527	0.999417	CS pos: 16-17. Pr: 0.9119

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_58732-t33_1-p1.