CAZyme Information: ASPWEDRAFT_55693-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_55693-t33_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		98330.12	9.2457

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:579648-582365(-)

Full Sequence      

MAPKTPRVLFLANSEHGQTNIILALIHELLVRGDIDVHLGSFPVLERRLEKLLKDNAHAY
DASFRSRIHFHPVRGPSNTDVFIRTGKRGAFHPPGYSGSILGFQSLIEDIWGWNEEEYVD
VYESCVEIVHKADPSIMVVDFFFLQGRDAAFNTGHTAILQNTTALSHIVLGLQKNNAWAW
KYPLPGTGFPYPLPWHLIPSNTMACIKTAKMYHGSGRRRDIRDWRIKHKIHGRFPFADAW
RPDRLHLSPALKELDWPFDVPDNVVACGPILLPCASVKTQDPEMDTWLAKAPTILVNLGT
LYAPDPDVALHIASGLKGFLDSWPDKNVQVLWKLPKHPHDDDDVYNRSVGALEEERKTDR
VRIQPWFEVEPLAMLETGRIVCSVHHGGANSWYEAIQNGVPHVILPAWQDCYENAARAEW
LGIGVYGNKSRAPNIDSKELSKALRKVMSSDSYQKKATELSRLCHKKEGRVAGCEKIVEL
AYNPDKMKIQLPDIKEEDHRGELSTVKSKSGKTLETVKPRYEGKPTSKYASHLHLLHEKI
ANHALNRSLPRGILETLIVLLTSNAWFLLPTIGYSLLLIPRLRYFVLLYILYIKYLASAH
KTGTSPLRNDTFRSSWFWKLYASYFPLTLYRSAPLSPKKRYIFGYHPHGIAIRGAVGAFA
ADGAGFSDLFPGIDNTLLMKDSSFHAPLLREYLLSLGLSGVSRSSCIKNLTRGGHDGRGM
GRSITIAVGGSREYAIAQPGKMGVVVKIRKGFVRVAVETGADLVPVLSFGENELFDQVDM
NSSSVGGLVARIWETYVGHKVTFALGRFGIFLPYRRPMNVVVGAPIEVKQQRWDPDQKYI
DELHERYVEELGKLFGEWKDVFGVDKSVKFEVVG

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_55693-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	178	481	1.1e-26	0.6518324607329843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
112781	DAGAT	3.65e-69	575	872	1	296	Diacylglycerol acyltransferase. The terminal step of triacylglycerol (TAG) formation is catalyzed by the enzyme diacylglycerol acyltransferase (DAGAT).
153249	LPLAT_MGAT-like	1.39e-42	621	860	1	212	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this suubgroup are such LPLATs as 2-acylglycerol O-acyltransferase (MGAT), and similar proteins.
178380	PLN02783	8.55e-34	622	863	82	306	diacylglycerol O-acyltransferase
340817	GT1_Gtf-like	7.61e-29	6	480	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.79e-13	7	480	3	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD62324.1|GT1	0.0	8	873	9	856
QRD94805.1|GT1	0.0	8	873	10	857
QMW45565.1|GT1	0.0	8	873	9	851
QMW33523.1|GT1	0.0	8	873	9	851
BCS09389.1|GT1	0.0	1	873	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	1.20e-06	384	465	91	169	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	6.39e-81	1	482	1	507	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|Q96UY2|DGT2A_UMBRA	1.22e-62	554	873	35	354	Diacylglycerol O-acyltransferase 2A OS=Umbelopsis ramanniana OX=41833 GN=DGAT2A PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	9.71e-60	1	444	1	434	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|O74850|DGAT2_SCHPO	3.57e-53	618	862	91	333	Diacylglycerol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dga1 PE=1 SV=3
sp|Q96PD6|MOGT1_HUMAN	2.56e-49	539	864	2	326	2-acylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=MOGAT1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_55693-t33_1-p1.