CAZyme Information: ASPWEDRAFT_55526-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_55526-t33_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KV878218|CGC4	44103.19	6.4507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:874177-875389(-)

Full Sequence      

MEDILVVMKTGVTEVREKVPVHINTTLKCVPHYVIFSDYEEEIAGVRTYDVLRSVSNETK
QANLDFGIYNRLHDQGREGLLAADWRDEANGPFGKPGNPGWKLDKWKFVPMMDEALQVRP
NAKWYVFIEADSYMVWPNLVAWLSRLDHKKPYYLGAPMQIGNILFAYGGSGIILSNPAMQ
MVSKHRAGQSTELEKFTADNWAGDCVLGKVLHDAGVRLLWSWPMLQTARVWELDHFAEGY
GRKPWCYPAISYHHMDTQDIEVMWHFDQEWFGDGKNSLLLHGDVFKRLILNETSNEHDNW
DNLSSENANEQHKDLVFQSADDCAKHCVQNSDCLQFSFDSGKCLTSKTVIRGVNHATMHS
GWMTKRIHMILKKMNSCPKVEYIT

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_55526-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.82e-04	123	256	86	228	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	2.65e-04	120	184	209	279	hypothetical protein; Provisional
394981	PAN_1	0.002	318	344	23	51	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK46394.1|GT31	5.19e-162	1	383	81	464
BCS21419.1|GT31	1.36e-158	1	384	69	450
CAP92758.1|GT31	1.91e-154	1	383	80	463
QGA14390.1|GT31	6.31e-144	1	383	70	458
QMW40773.1|GT31	2.45e-141	1	383	60	437

PDB Hits     

ASPWEDRAFT_55526-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPWEDRAFT_55526-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000091	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_55526-t33_1-p1.