CAZyme Information: ASPWEDRAFT_55305-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_55305-t33_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	KV878218|CGC3	63692.78	5.5396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878218:139509-141475(-)

Full Sequence      

MGSVVDSADVFDYIVCGGGTSGCVVAGRLAEDPTLKVLVIEAGQHNRDLENTHMTGGWSQ
NFDSETDWNVVTKPMAGVDNRQVKLSRGRFLGGCSGCNGTLCLRGSKQDYDDWGLEGWSG
DEFFAAMRKAETFHTKPWFKADAKSHGYSGPLHIEPHDLAPISQLLMDSFVSSGLPLNHD
MFSTGDVPHGCGHAPRTVNKGIRTTSADFITNEYHRNNITIQTDTTVDRILLEPGADGPR
ASGVVTKLADGTSRTFYARKEIVISSGAYCSPAILLRSGIGAKEELEKLDIECQVDLPGV
GKNLMDHLIVFMFYETEKEGLTDDWHVYHDDNFGKTYMQWKEHKTGFLSTFPFGGFAFAR
MDERLQDEPLWRDAPREPGRDPMGLTPKQPNVEFFTTECYGGPKQYDQFPIDHKHAFSMI
AELFAPKSRGTVTINTKDAMETPVVDCNYLADPMDMLVLSEACRFGNEIVMNGAGTKDIV
KGSWPSDLTHHKYTTREEWIPYVKEHATTCYHASGTCAMGKDDNPMAVLDNKLRVKGVAG
LRVADCSVMPTLHGGHTQMPAYGIGERCADIIKETW

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_55305-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	574	8.9e-160	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.53e-98	5	574	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.34e-97	11	573	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.93e-35	426	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.36e-35	78	309	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.05e-24	3	548	48	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65288.1|AA3_2	0.0	1	576	1	574
QMW48130.1|AA3_2	0.0	1	576	1	574
QMW36070.1|AA3_2	0.0	1	576	1	574
QRD92967.1|AA3_2	0.0	1	576	1	583
BCS27972.1|AA3_2	0.0	1	576	1	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	7.60e-69	11	573	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.06e-68	11	573	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.48e-68	11	573	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	2.31e-61	11	573	14	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.21e-61	11	573	14	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.65e-72	11	573	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q39A44|BETA_BURL3	7.61e-71	11	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1
sp|B4EHJ2|BETA_BURCJ	1.48e-70	11	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=betA PE=3 SV=1
sp|A0B2F7|BETA_BURCH	4.04e-70	11	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) OX=331272 GN=betA PE=3 SV=1
sp|Q1BQE2|BETA_BURCA	4.04e-70	11	573	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_55305-t33_1-p1.