CAZyme Information: ASPWEDRAFT_53926-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_53926-t33_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		83322.57	7.8382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878215:1513232-1516270(+)

Full Sequence      

MNQSTILFLTNSELGQSSIILAVAHEFILRPSSYSVHIASFSPLHDAVSKLNSRAVSLSH
SSHPIGAVTFHRIEGSCFDVHRTGFRGALEACKNVLPALLAVWNGPEYMAIYHNCVDIIS
QLQPAIIVVGPLFYQAIDACRVLKAKYVPRLANVWKFSAMCSGYSYPLPWRLVLPNAYLI
LKLVYSVHTATEYKGLRKYRNAHGIPGPNPSMAIMAGDKTPHLLPGSVDAEFPCVLPAHF
TLCGPILRPCLPISEENPDLAVWLSQRPTFLINLGSHVTFNSTVQRQFADALQLLFNQRR
DIQVLWKMKLANDTRPDIKALKGISDFISNGRVRIETWLSVDPIGVLQSDRVAWVVHHGV
VNSYYEAIRAGVTQIVLPIWFDTFDFAARVEWLGIGTWANRKNGPGVDGQELGQSLIRAI
ASDESSKMRQKAEAITNGESERRPEKQTIQAHSDTMASQNVAFIGVGNIGRGMCKNLALK
GPQTSLVLYNRTESKATAFANTLPPNKAIVASSIPSAVQQADIIFICVGDDPALHKIIST
ILSDTETNPDLSSKIIVDCSTVHPDTSRRARDDLAARGASFVACPVFGVPAVAEAGQLIV
VPAGASEAVERLRPFLDGVVSRQTINVNSSDPGNATALKLMGNTFILNTVETLAEGMAAA
EKTGVGAAAYQEWVHAMYPGPIAKYADRMAHGDYHRLEEPLFAVDLARKDIGHARNLAGA
TGMRLPTAELTDKYLQDVKAERGEKGDLAAIYGAIRKEAGLPFEN

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_53926-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224995	MmsB	4.41e-53	461	756	3	286	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase [Lipid transport and metabolism].
397486	NAD_binding_2	1.48e-31	460	617	1	149	NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
340817	GT1_Gtf-like	2.32e-24	6	444	3	397	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
185358	PRK15461	1.00e-19	461	762	4	293	sulfolactaldehyde 3-reductase.
185019	PRK15059	4.41e-16	461	755	3	283	2-hydroxy-3-oxopropionate reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57970.1|GT1	7.76e-264	1	765	1	829
QMW42118.1|GT1	4.49e-146	1	435	1	460
QMW30045.1|GT1	8.17e-146	1	435	1	460
UDD61742.1|GT1	8.17e-146	1	435	1	460
BCS26405.1|GT1	6.53e-140	1	437	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WP4_A	3.25e-16	459	761	2	286	Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_B Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_C Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8],1WP4_D Structure of TT368 protein from Thermus Thermophilus HB8 [Thermus thermophilus HB8]
2CVZ_A	3.53e-15	459	761	2	286	Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_B Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_C Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8],2CVZ_D Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8 [Thermus thermophilus HB8]
6SM7_A	2.61e-14	461	761	4	292	Crystal structure of SLA Reductase YihU from E. Coli [Escherichia coli],6SM7_B Crystal structure of SLA Reductase YihU from E. Coli [Escherichia coli],6SM7_C Crystal structure of SLA Reductase YihU from E. Coli [Escherichia coli],6SM7_D Crystal structure of SLA Reductase YihU from E. Coli [Escherichia coli],6SMY_A Crystal structure of SLA Reductase YihU from E. Coli with NADH and product DHPS [Escherichia coli K-12],6SMY_B Crystal structure of SLA Reductase YihU from E. Coli with NADH and product DHPS [Escherichia coli K-12],6SMY_C Crystal structure of SLA Reductase YihU from E. Coli with NADH and product DHPS [Escherichia coli K-12],6SMY_D Crystal structure of SLA Reductase YihU from E. Coli with NADH and product DHPS [Escherichia coli K-12],6SMZ_A Crystal structure of SLA Reductase YihU from E. Coli in complex with NADH [Escherichia coli K-12],6SMZ_B Crystal structure of SLA Reductase YihU from E. Coli in complex with NADH [Escherichia coli K-12],6SMZ_C Crystal structure of SLA Reductase YihU from E. Coli in complex with NADH [Escherichia coli K-12],6SMZ_D Crystal structure of SLA Reductase YihU from E. Coli in complex with NADH [Escherichia coli K-12]
5JE8_A	2.64e-13	459	758	8	296	The crystal structure of Bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD [Bacillus cereus ATCC 14579],5JE8_B The crystal structure of Bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD [Bacillus cereus ATCC 14579],5JE8_C The crystal structure of Bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD [Bacillus cereus ATCC 14579],5JE8_D The crystal structure of Bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD [Bacillus cereus ATCC 14579]
3PEF_A	2.34e-12	458	752	1	282	Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_B Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_C Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_D Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_E Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_F Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_G Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens],3PEF_H Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter metallireducens in complex with NADP+ [Geobacter metallireducens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	7.84e-86	6	418	8	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	7.25e-67	5	420	7	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|O33730|Y1503_SHEFN	7.16e-19	461	757	4	288	Uncharacterized oxidoreductase Sfri_1503 OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=Sfri_1503 PE=3 SV=2
sp|O34969|YFJR_BACSU	3.26e-17	461	756	3	286	Uncharacterized oxidoreductase YfjR OS=Bacillus subtilis (strain 168) OX=224308 GN=yfjR PE=3 SV=2
sp|P0A9V9|SQUU_SHIFL	1.22e-13	461	761	4	292	3-sulfolactaldehyde reductase OS=Shigella flexneri OX=623 GN=yihU PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000092

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_53926-t33_1-p1.