CAZyme Information: ASPWEDRAFT_52750-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_52750-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		61841.24	4.7370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878213:2421492-2423245(-)

Full Sequence      

MFLLIYYLTLVGGAIAAPFLQRLNDTTHVIGNDLWNITIGRQYGVKLYYKEHDLVGDAWG
HYVSYNGAQSDLNWTSGDIHHQGDDYLDVRFTANEGDFHWVIFDGLAGAYQYFINRALPV
LGEFRTLFRLDNTTFPNGRTNIKDEALPTLSDILNSTKVQDETWQRADGSYITKYDFSTF
IREQDYYGVYGDEFGSWYIHPGKDYYNGNQLKQELTVHRESATGDAVQLNMIHGTHFQAS
SSDAFPDGKVWGPWLWYLNDGSKSDAKDRADKEFASWPYTWFDDADYHSRGSVSGRLVLS
DGRAASGASVFLGDNHPNKTALDMGTLYYYTSQADDKGNFIFENVRTGEYGLQAWSDGGE
IRDVSTTLQYNDVKVEEKENKLGQINWDSPPRNIIFQIGDFDRKTLGFKYGGSPYEHAVV
ARCPKNLTYTVGSSKTEDWCFGQSSGTWRILFTSNTTSPATLTISLAGYSSGTTAQILLN
GSKIGNLTSLSNDPGLYRSATTAGEWRVVQVEIGGMRRGWNAIDLEVQESSEWRGFMWDS
LLLAGDVVSY

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_52750-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	29	530	3.4e-234	0.9922928709055877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	9.79e-61	28	266	19	264	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	6.92e-38	395	543	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	8.57e-27	396	543	1	160	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	6.88e-15	289	359	1	70	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
404503	CarboxypepD_reg	6.28e-06	292	380	1	74	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65538.1|PL4_5	1.19e-247	17	543	27	572
UQC83548.1|PL4_5	1.99e-234	10	541	130	703
CBY02118.1|PL4_5	9.30e-232	19	543	32	568
BCS19874.1|PL4_5	3.66e-229	18	543	29	570
QRC94889.1|PL4_5	2.88e-228	19	543	31	568

PDB Hits     

ASPWEDRAFT_52750-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	8.14e-68	86	527	113	561	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000536	0.999476	CS pos: 16-17. Pr: 0.9632

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_52750-t33_1-p1.