CAZyme Information: ASPWEDRAFT_51804-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_51804-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027		112023.62	6.8160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:3244386-3249920(+)

Full Sequence      

MRVLGAAALGIALLSTTIMAASVKELEALLPKCALKCMAVTIPKSSCTLTDQTCQCTDTT
YTALLQECVVSSCTIKESLTTKNVTTTACGAPVRDRTKAVSYAGVIGLVIACIAFVLRIV
ARFKCLGGTFGMDDLTMGLTMCLVIPLSALSVVLADTGLGRDMWTLPFTNVTQVLYIYFW
DELLYLSILPMTKISICCFYLRIFPARNFRTLTYIVIGLNIAYLLAFVLISVFQCRPIQG
AWLRWDGEGNYKCNHINAQGWASAIINMVLDLIVMILPLKQLYNLNLSIKKKTFVMCMFS
FGIFVTVVSILRLDSLIKFASTDNVTWDYVTVGYWSTIECHVGVICACLPAIRFLLRKAA
PKLFGGTSVNQSFGVNSTSRGTGSRLEGAIHKDATEYDYVVVGSGAGGGPVAARLAIAGH
KVLLLDAGDDQGNATVQQVPALQLQSTEYEPMRWDYFVQHYSNLTRQKEDSKMTYRTSAG
DLHVGPNPPGGSDPLGILYPRAGTLGGCTSHNAMITIYPYEHDWNHLASITGNDSWSADN
MRQYFERLEKNRYLPSSVAGHGLDGWLMTSLTDLRLVIEDQKLLSLILAAATAAGKSLLE
KVITTVTGLGEVLLRDLNSPSPTRDYETGPYQVPLAVELPEHRRTGPRDFILNTANAVNS
DGSRKYHLDMQLNTLVSKIQFDTSGVRPRASGVEYLTGQSLYRADPRASLTSSLGTPGSV
KASREVILAAGSFNTPQLLKLSGIGPQEELSKHGIETLVNLPGVGSNLQDRYETGVIGES
PTNFVLTEKCTFLYSSPDPCLEQWKNGTLFKGTYTTNGIAIAVTRKSSTADDTPDLLVSG
APVKFPGYYPNYSYEGLKESNHWTWITLKAQSRNNAGSVELRSTNPRDTPVITFNSFDTG
TTTDGADEKDLQAVHDAMEFSRTIFRDLVPLDGGFTEIWPGPNVTAGSELKDFIKREAWG
HHACCTAPIGEDSDPKAVLDSDFRVRGVKGLRVVDASVFPKIPGYYIALPIYMISEKAAE
VIIADAA

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_51804-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	396	1024	1.1e-93	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.45e-61	414	1027	25	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.47e-58	675	1022	223	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.47e-33	877	1018	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.43e-20	676	1004	243	558	Protein HOTHEAD
399033	CFEM	1.37e-17	28	90	3	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05589.1|AA3	0.0	408	1027	49	668
BCS17142.1|AA3	0.0	408	1027	49	668
CAK41424.1|AA3	0.0	408	1027	49	628
QMW39616.1|AA3	0.0	354	1027	7	678
QMW27545.1|AA3	0.0	354	1027	7	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	2.53e-37	396	1022	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.53e-37	396	1022	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	6.10e-37	396	1022	13	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
4H7U_A	3.80e-36	396	1022	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZH7_A	4.19e-33	394	1022	5	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6X2G7|BETA_BRUA4	6.92e-43	396	1020	2	523	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	9.91e-42	395	1025	3	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.47e-41	384	1022	32	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	2.14e-41	397	1023	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.39e-41	355	1026	11	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999731	CS pos: 20-21. Pr: 0.9712

TMHMM  Annotations     

Start	End
4	23
99	121
136	155
184	206
211	233
260	279
294	311
332	354