CAZyme Information: ASPWEDRAFT_49331-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_49331-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		92931.09	6.5956

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:3316935-3319684(-)

Full Sequence      

MPPSEVQKKVGQLFAVGFHGLTPSPEIKTLIHDYGVGGIILFKRNVRDAAQLQALTLALQ
NEARIAGHEHPLFIGIDQENGLVTRISPPIAAQLPGPMALGATHSPELAYQVGKVTGETL
GFFGINMNYAPVCDINSEPLNPVIGVRSPGDDPEIVGRFASATARGLREQNVVPSVKHFP
GHGDTAVDSHYGLPVVPKTRNDLERCELIPFRRAVAEGVEAVMTAHIALPAIGDGQLPAT
LSPGALNILRKDMKYDGMVITDCLEMDGIRATYGTERGSVLALNAGSDSIMICHTYSVQV
ASIKEVDQAVQSGTMPSSRLDEAYRRVTKLKGNLLSWGTALQPRDMETLVSLNRKGSQLA
KEAYSRSVTLVRSKPNVLPLSKSSTLVFLFPGAKTPAGGAVDGEGLGRKGSYNATEFVDI
LRPHNQSVVEIRYGTAGLSTEEWGLVDAADAVIFVSINARESPYQSSLGQELPKHTRALV
TVAASNPYDFLEDESLETYITTYEPTIEAFTAALDVMFGSTVTKGTLPVGPGKTAQSPIS
ISSFDAANDLEQLAIVWNAALPSYPLSKETLQRLVVRPSGHHFVARVGSTVVGFCLAYTT
VNRGKISGQLAVLAVDPKYQSQGVGTRLLTETRSWLRNHLNLNNLIVGSAFPRFWPAIPR
DLPQEVQEFFIHRGFRLNPPVPRSVDLYQDIVNFQAPEKYIVRARELGYTFAPLQPEHYE
ECIAAQERNFSSYTGWVEAYVALNPKNCPSSVMVAFDPQGKQVAWTLMLPPSSPLLERDW
AFPPLCGPKTGLIGCVGVDSAYRKGGIGLALLCHAIEDMKQRGIEGVFVDWVSLDGWYEQ
VGFKVWRSYRTGEI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	291	1.3e-59	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.70e-94	9	431	6	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.02e-86	9	330	5	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	6.60e-47	36	294	26	281	beta-hexosaminidase; Provisional
185053	PRK15098	5.22e-18	6	539	47	608	beta-glucosidase BglX.
224167	ArgA	2.19e-08	781	850	56	135	N-acetylglutamate synthase or related acetyltransferase, GNAT family [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85716.1|GH3	0.0	1	854	1	854
CAP94355.1|GH3	0.0	5	854	5	852
QMW40223.1|GH3	0.0	1	854	1	863
QMW28153.1|GH3	0.0	1	854	1	863
QQK41162.1|GH3	0.0	1	854	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	6.52e-160	6	854	9	858	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.30e-101	6	528	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.74e-66	26	529	76	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.13e-66	26	529	50	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	9.63e-66	26	529	80	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	8.97e-66	26	529	76	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.82e-55	22	389	50	434	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	2.56e-40	9	332	64	381	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	6.42e-40	9	332	64	381	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	2.62e-38	16	294	8	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_49331-t33_1-p1.