CAZyme Information: ASPWEDRAFT_48851-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_48851-t33_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	KV878210|CGC20	42898.79	5.9764

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:1625789-1627001(+)

Full Sequence      

MRGSLAVFLTALGGIQPSLALPHSHTSYVDWKTFKANGVNLGGWLVQESTIDTQFWNTYS
GGASDEWGLCQNLGSQCGPVLEHRYSTFITKTDIDKLADAGVGILRIPTTYAAWIKLPGS
QLYSGNQTVALKEIADYAIKSYGMHIIVDIHSLPGGTNGKDIGEATDHFGWFHNTTAFDN
SLKAIDAVISFVQNSGSPQSYTIEPMNEPSDSRNMSTFGTPAALSDRGATWVLKYIKAVI
NKVEEANSKIPVMFQGSFKYPSYWSGNFSADTNLVFDVHNYYFEGRPTTSENLPTYICSD
AKNKAVDDTFPVFVGEWSIQAKQNNTFALRSRNVNTGIQAFHNYAQGSSYWTAKFSGNAT
VNGQGTQADYWSYPYLVSGSSMDMAIIHDW

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	85	364	8.6e-147	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.21e-13	32	371	14	337	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.22e-12	78	324	12	243	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31304.1|GH5_23	3.36e-206	1	389	1	390
QMW43350.1|GH5_23	3.36e-206	1	389	1	390
BAE61018.1|GH5_23	3.36e-206	1	389	1	390
QRD90261.1|GH5_23	3.36e-206	1	389	1	390
UDD60193.1|GH5_23	3.36e-206	1	389	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	1.43e-201	28	389	11	371	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	2.43e-185	25	377	11	364	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	2.19e-10	35	319	2	298	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.23e-09	35	319	2	298	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.49e-31	26	318	32	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	9.35e-26	2	369	8	352	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.75e-25	2	369	8	352	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	2.16e-25	30	374	33	394	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|A1D4Q5|EXGA_NEOFI	2.39e-25	17	369	24	352	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999746	CS pos: 20-21. Pr: 0.9816

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_48851-t33_1-p1.