CAZyme Information: ASPWEDRAFT_48429-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_48429-t33_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		66433.19	5.4554

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:84990-86867(+)

Full Sequence      

MTIDTSIPTNLHESYDYIVVGGGTSGLVVANRLTEDPSVNVLVLEAGSNRVDDPRIAAPG
LAVATYDDPDFDWCLTSVPQEHLNGRRLAEPRGRTLGGSSAINLGMVIYPSKTDLNAWEQ
LGNDGWNWESISPYMRKSQTFTPPSAEVREQLSLNYLDESIQGTDGPLQVSFGEGPFLPF
NSAWPKVFEALNHSITGDPMSGVAQGAFCNPGSIHPTTRHRSHAGVSYYNAEVAQRANLR
VVTDALVEKIILKKQGEDVIATGVQFTGKDGVQQTISAGAEVILAAGAIKTPHVLELSGI
GDAKLLQSHGIETVIDNPAVGENLQEHGFVPFSWQMADGFMGGEALREPEIAKMAMEGWQ
TAGAGPLGLCAIHSAYMTPPDLRDGEMNRLIQEYLTTPATPGLEAQYDVLRQLLEDTNEP
SGQYTIAPFEATPEKGPAMKGIFSMAEPGSFLSIVAVLNRPFSRGFVHTQSNNPKDLPLF
DPKFLSHPLDMELHARHTNWLETLAGTEPMASLLKPNGRRLHHHERVSSLETARELTRDR
IVAHYHVAGSCAMMPKEKGGVVDSKLKVYGTKNLRIVDASVLPVIPRGNIQTTVYAVAEK
VADIIKQERKL

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_48429-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	607	9.5e-175	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.02e-95	8	611	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.37e-87	13	606	4	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.08e-34	461	600	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.22e-30	84	327	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.19e-29	12	594	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40027.1|AA3_2	1.01e-315	1	609	1	613
BCS13057.1|AA3_2	9.93e-314	1	609	2	614
BCS01313.1|AA3_2	9.93e-314	1	609	2	614
QGA17771.1|AA3_2	3.55e-310	2	609	3	612
BCS27275.1|AA3_2	1.87e-222	3	608	4	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.63e-76	14	610	5	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	4.10e-75	10	611	1	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	9.41e-73	9	608	30	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	1.21e-71	15	609	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.51e-71	15	609	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	7.41e-89	5	605	4	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	7.59e-89	11	608	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	7.59e-89	11	608	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.77e-83	13	605	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.77e-83	13	605	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_48429-t33_1-p1.