CAZyme Information: ASPWEDRAFT_48374-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_48374-t33_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822		90000.48	6.6958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878209:4977658-4980389(-)

Full Sequence      

MSSSHRDPPENTPPDDIPDVGTDVQEDGRIDLDLDSHACQTVVKLINWPSEEEVLVPPVA
DFDPYTTCDIKLNIVIQVVGSRGDVQPFVALGNELQKYGHRVRLATHNTFDSFVRQSGLE
FYPVGGDPAELMAYMVKNPGLIPKMKSLREGDIKKKRRMVAEILQGCWKSCIEDDPISKT
PFVADAIIANPPSFAHVHCAQALGIPVHMMFTMPWSSTREYAHPLANLKYSSTNPNFANY
ASYGIVEWMTWQGLGDVINSFRSTIDLEAVPMTEGPNLAETLKVPFTYCWSPALMPKPKD
WPSHIDVCGFFFRDPPDYSPPPDLAHFLQSGPTPIYIGFGSIVIDDPPRVTAILLEAIRA
TGVRAVISRGWSKLGGDSTDDIFYLDDCPHEWLFQHVTAVIHHGGAGTTACGLRFGRPTT
IVPFFGDQTFWGNMVAASGAGPPPIPNRSLDAKNLADAIRFCGLPETVAAAGDIADRMSA
ETGVQTAVESFHRNLPVDEMRCQILLNEPAVWSYKKSGTKPLCLSRKAGEILLDHSCVEP
KALQLYEARPIIIQTRRWDPVTGTMSAFVGASADMVKSASDVVIRPYREINRRQSDSSSS
ATPRSQRSQSTTDRDMQALSEMPESAIREERKPSWDTTAVALGQSAKGVGKLVGKYYKGM
GVDVPLATTEGLRAVPRLYGEEVKEYEPIRDLRSGLSVGGKNFTHGITEGVAGLLKQPYK
GAVKEGPIGVVKGFAKGGIGLGSMVSSAALGLVAYPGHGLCKTIHAAIKSKTRKNIVNAR
HREGRYLVHVDTEIDREAIIDSFEVLKQNNISTRSSWRTESS

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	127	492	3.1e-50	0.887434554973822

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.39e-76	72	493	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.92e-35	74	493	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.75e-24	74	221	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.61e-05	648	789	2300	2432	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26390.1|GT1	0.0	17	812	27	812
QMW38469.1|GT1	0.0	17	812	27	812
UCK58945.1|GT1	0.0	24	812	35	829
QRD87509.1|GT1	0.0	24	812	35	829
BAC56174.1|GT1	0.0	26	812	42	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.05e-74	61	495	5	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.12e-74	61	495	25	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.20e-31	72	475	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.05e-27	72	441	1	329	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.12e-23	72	475	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.25e-130	71	496	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	8.32e-124	72	510	193	625	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A1CYS1|ATG26_NEOFI	6.73e-76	71	495	910	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	1.26e-75	72	496	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q4WID6|ATG26_ASPFU	3.96e-75	71	495	901	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_48374-t33_1-p1.