CAZyme Information: ASPWEDRAFT_43960-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_43960-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1263		138752.93	6.8874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878215:740758-744549(-)

Full Sequence      

MIPLSPSKHRHQPQILPIDKLNTTDEPCLTALPEMNSLSEVVNTILNQAVTLQRLQASGA
EGRSGCSIYFARSDQSEVPIAVVKVYPPQRQGDLFDELASYKKILSLPNTPSAVAPIGVG
RTRDEESGAPAGVVVYQPAKGKAINTMIRDVGRITAFRDLARNVVIDYEARDGLLQFIED
NRENIPVDWREVDGLKGRCVDGFFAALPAFLETRYEKLLEDLLCAVRAMASVLAKLHTAE
RGQWNDASEKTMEKMRTRVRGWMEEIQSSATVEYDNAGIGPDRRQEMHKMVEHVIYEARH
PTSTSLTHGDASSGNFFWDPAIGVTMIDYGGLHWSMDVAGKPIGLAEIDAAGFYERLRKY
APAFGVKPEDIGSVQEAFWDTYTQLNPELNLSVARLVRLRIQMSRLWSAVDKFNRTPDAS
HAAVETEYERLCSISGIHETVPKFKVLMVANASGRGKGGIPLLNRELVNAMASLKNASVT
LFLVDDAITNEHHPNAKVISIPCASGHSASELLYYVAKVHQPQGFGLPEQNEISPPFDLI
VGHSRYSSAAAAIIRDRWYPTAKLALITHTSPLRKSDAAWTWYGGSRQKGYEEAARLALL
DEKILPKADLAIGVGPVLTNEAREREWMGQLSRPRSIVSGPRFHEMIPGVHIEESIKRQR
QPDDVFRVLLAGRADDPAKGVDDAIYAVWQLAMAPRASITLDILGVPAEELQERQKHVDQ
MTGIKGLVQFHPFSNDQTVVRRSYQAADLVVMPSTHEGFGMIFTEVAGMGVPILVTEDSG
AGQFALDSSRIPARLGNAVVVMDESAYGIPASAQSNRVAIWADRIDWIRRNPVQAMQNAT
ELQDIMRAYSWEHAAEALLDAAMHDAGDTVQTANGTLSPRLSPLAPEVKVSMQCAAQSRN
GSGVPEKTKATAVLQTLPRIGHCKHALEHFVSKALGHHVDLKPLTDSHVKGFSGAPVFIA
HHPKQGGEVAVVKLFLQSLDNGITEELSSLEWLLHRAKDINTPTPIAVGQMSWNGKPAGV
VAYKVAQGASLYQLMMQLGKKCGKERAEIFAILKSGSQAAATTLTKLHSYAIQGRSSEGY
LAWYYSAAPQRVDRLESFTSILEHTGLDVYQLRQQVNKLIARCQQEIRQNPRTAVVHGDA
HPGNFFFDRNTKRTTIIDVTTLHCSLDAEGNPAGTPERDVGHFLHMLRRTGEQSGMTEDE
MEQCARVFVDTYYNGGGSVGIQTLRLLAVCSALSFVGNAVQKNGNVLKEVKILGEMFALG
NGS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_43960-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	3.00e-22	445	860	1	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	6.74e-17	445	860	2	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340830	GT4_sucrose_synthase	1.41e-13	465	860	28	398	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
404563	Glyco_trans_1_4	2.13e-12	666	776	2	103	Glycosyl transferases group 1.
340816	Glycosyltransferase_GTB-type	2.41e-11	564	787	1	228	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31956.1|GT4	0.0	3	1259	6	1300
QRD91027.1|GT4	0.0	3	1259	6	1300
BAE61714.1|GT4	0.0	35	1259	1	1264
UDD60927.1|GT4	0.0	326	1259	1	963
QQK42333.1|GT4	0.0	10	1262	8	1290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	6.90e-06	583	838	168	409	Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1SP12|MSHA_NOCSJ	2.19e-09	537	860	142	445	D-inositol 3-phosphate glycosyltransferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=mshA PE=3 SV=1
sp|D5UJ42|MSHA_CELFN	1.47e-08	537	859	138	433	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
sp|C7MSY6|MSHA_SACVD	9.22e-07	502	860	87	413	D-inositol 3-phosphate glycosyltransferase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) OX=471857 GN=mshA PE=3 SV=1
sp|B1VEI4|MSHA_CORU7	2.09e-06	537	860	103	401	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) OX=504474 GN=mshA PE=3 SV=1
sp|Q5YP47|MSHA_NOCFA	2.22e-06	529	861	108	412	D-inositol 3-phosphate glycosyltransferase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999922	0.000125

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_43960-t33_1-p1.