CAZyme Information: ASPWEDRAFT_43573-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_43573-t33_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	KV878214|CGC10	40057.45	8.1182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878214:2371483-2372580(+)

Full Sequence      

MTSVRLPFSILTLLISLILSLAAAAPSPVVKRGVKLDGEPSEMGKGTYPRATYIEDKSLL
GCFRGLHDDKVTLETVRSTDKGKTWSPVGTIISEVEKTHGLNNCYLHQLPKSDRILAAFR
NPERDPKTNKYTKYIMSVYFSDDQGKKWEPLSTVATTTTRGLGVWEPFMMDGLNGDLMLF
FSRETRTDGKDQNSILVRSTDGGKTWGKEETISGGDIQKRDGMLGVARLAPDSEKMIAVF
ESLTPNTGITSITSSDDGKTWSNDRKIVYKGTNGPPSESAPQVVRIGKTLVASFSTWEDD
REAGKSKPPNVKIVTSRDQGATWGEKTLIHKNCHWAGEVAIDDTSLLVMCDYNNGTAIAQ
RVSIA

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_43573-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	45	301	1.2e-50	0.8697068403908795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.72e-15	77	331	51	301	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	3.60e-12	75	273	115	304	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.03e-11	174	364	24	229	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	1.17e-05	175	361	1	190	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	1.21e-05	76	227	177	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58461.1|GH93	1.24e-144	1	364	1	359
QKX54349.1|GH93	7.41e-70	27	365	23	363
QKX63957.1|GH93	2.04e-63	36	365	35	365
QGA18927.1|GH93	6.90e-62	27	364	26	355
UQC86738.1|GH93	1.07e-50	20	360	24	357

PDB Hits     

ASPWEDRAFT_43573-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPWEDRAFT_43573-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999722	CS pos: 24-25. Pr: 0.9646

TMHMM  Annotations     

Start	End
7	29