CAZyme Information: ASPWEDRAFT_42591-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_42591-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	KV878213|CGC5	60836.11	7.3360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878213:2535300-2536955(+)

Full Sequence      

MDESLAHPSRKILLVVTTGGFTHASPVFEIGRVLSERGHRIEFATLDGQEHWIKGYEFIS
KIHPLGPGPTAEQLNAHYLRMRSWDMSKGINMDSKYMFDSFWPQTYRGLKAIMEDPATRP
AMMVGDFFVDAVKDMLVEYRIPIAMVWPNMPFLMMPCKYIPGEPGFQIDGTTTSENASMW
LRIKNELVPVLSLPTIIKWMKWTGQMRRRTGVTYPVHKIQKPDYLIFVNSFFGLEIPRDL
PPTCAAVGPLLSDTYAALDGELDTFLSQHKSVIYIALGTHIIVSNHEATKIINALIRLLE
AQLIDGVIWAVAQSGRQDLDVDSTFQTSKRQLRLGDLLDGHHPDWMFSFFAPQRAILDHE
STKIYFTHGGGSSANEGLFHGKPMLSMGIFGDQIQNTTRLVAGGVAESLNKYHFTSDELY
TKAQDIIRDEDGTFHRNALRMMRIAHVASRRKYHAGDLIEEMMYDNELRFKDGKELRPMH
LQTADMRMPAYKAKNWDMYAVFAVGFAAMVASTAFGGKWLWRNRNVIEPVTSFLGS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_42591-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	63	448	6.1e-23	0.8455497382198953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.96e-34	14	462	4	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	4.72e-16	351	516	330	480	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	3.58e-12	225	430	248	433	ecdysteroid UDP-glucosyltransferase; Provisional
224732	YjiC	7.53e-12	9	463	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215247	PLN02448	2.52e-07	113	402	94	381	UDP-glycosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59607.1|GT1	1.06e-296	1	527	1	533
BCR88254.1|GT1	2.70e-268	1	524	1	530
QQK45460.1|GT1	2.24e-258	1	532	1	539
QLI65751.1|GT1	4.00e-257	5	536	1	532
CAK97035.1|GT1	8.41e-254	1	534	1	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	4.24e-11	248	446	19	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	2.59e-09	258	429	8	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	6.98e-09	339	446	59	169	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6PNT_A	7.95e-09	350	430	324	402	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
5NLM_A	4.34e-07	226	411	216	417	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36514|UD2C1_RABIT	9.43e-18	153	446	160	423	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q6UWM9|UD2A3_HUMAN	7.40e-16	153	446	185	448	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|P36512|UDB13_RABIT	1.32e-15	228	446	260	452	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q6NUS8|UD3A1_HUMAN	2.28e-15	5	430	18	431	UDP-glucuronosyltransferase 3A1 OS=Homo sapiens OX=9606 GN=UGT3A1 PE=2 SV=1
sp|Q5RFJ3|UD2A3_PONAB	7.15e-15	228	446	256	448	UDP-glucuronosyltransferase 2A3 OS=Pongo abelii OX=9601 GN=UGT2A3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000040

TMHMM  Annotations     

Start	End
499	521