CAZyme Information: ASPWEDRAFT_41422-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_41422-t33_1-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	KV878212|CGC23	57598.67	5.8424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:4008691-4010292(+)

Full Sequence      

MSTYDYIICGGGTVGCVLASRLSQAGHSVLLAEAGPEDYNELVMNPLGSALLHDTDFEYK
FTATDQPHLGNRPVINHGGKLLSGSTAVNYGMWTRGHSRDYDAWAEHVGDERWNYQNMLP
YLKATETHHTHTASSDIHGFAGPISTTMGKRDYPLREPLRNSLTEAGLIFNSDANNGHPF
GFSFMTETWKNAQRQPAGKAYDLSKATIHTNSVVSRILIESNKATGITLVDGTEYRASKE
VIVSCGALKTPQLLMLSGIGPKEHLEEHNIHTIADLPVGYNYHDHVAGSIFWKLKNSDQG
LALGSPQFSNPQYLHGNTTDWVVTTSTPRDGLIAAAKADKIDPQDPYIREERANGEIIIY
YAPIAGGGTQFSLPLDGQHIATLAVLLLPTSRGRVSLANTDPMSNPVVDPNYLATATDRA
ALRSTIRLAFKIMETDAAKEAIAGETPPPGHNALTSSCTDEDLDERIDIIGSSLYQNAGT
AAMGTVVDSQCRVLGVRGLRVCDASVLPLPIAGHYQAPMYAMGEAVADIILNS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_41422-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	532	6e-141	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.90e-102	1	531	3	532	choline dehydrogenase; Validated
225186	BetA	1.81e-97	3	532	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	7.56e-60	5	531	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	6.55e-37	389	524	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.74e-35	70	287	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK37991.1|AA3_2	6.04e-241	3	531	4	533
QKX54325.1|AA3_2	1.55e-240	3	531	4	531
BCS16263.1|AA3_2	2.11e-158	2	532	3	553
BCS04695.1|AA3_2	2.11e-158	2	532	3	553
CAK40717.1|AA3_2	1.25e-154	3	531	4	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.06e-55	2	530	4	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.83e-55	4	530	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.91e-55	4	530	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.46e-54	4	533	41	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	3.24e-47	2	530	5	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	4.83e-244	3	531	4	519	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.90e-70	4	532	2	529	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	1.02e-65	5	530	6	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	1.02e-65	5	530	6	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	1.02e-65	5	530	6	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_41422-t33_1-p1.