CAZyme Information: ASPWEDRAFT_40608-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_40608-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	KV878212|CGC8	33246.87	4.5350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:2018053-2019162(+)

Full Sequence      

MRLTNALLMLAAAGTAAAGSKRGAFGLALGNQNTDASCKGTSDYEADFDALKDLTTLVRT
YSASNCDTAKNIIPAAKSKGFKVVLAVWPDTTDAFNADFEALKSSVPGNEDVVEAITVGS
EVLYRGNMKAPDLLNRINQVKKEFPNTLVGTVDSWNKFADGSADPIIQGGVTYFLANGFA
YWQDQKISNASNTYFDDMSQAKNHIEEVAKENAKNIRFGNGETGWPTDGGSNYGDSIAGN
DNAEEFYKKGVCAMLTWGVDVFYFEAFDETWKPDSKGDNGQVMNEKHWGLYTDKRVPKFD
TTCPSS

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_40608-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	26	303	2.8e-37	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.98e-63	23	295	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.16e-42	24	303	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25884.1|GH17	6.89e-165	1	305	1	303
BCR86239.1|GH17	4.77e-157	1	306	1	308
EAA66273.1|GH17	1.89e-155	1	305	182	485
CAK45395.1|GH17	1.36e-145	1	303	1	301
CAE47872.1|GH17|2.4.1.-	7.60e-145	1	304	1	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.08e-32	37	287	48	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.04e-32	37	287	48	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.14e-117	1	303	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	4.50e-72	15	306	17	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	4.38e-71	29	303	26	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	4.94e-70	29	303	26	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.44e-60	20	305	37	320	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999709	CS pos: 18-19. Pr: 0.9846

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_40608-t33_1-p1.