CAZyme Information: ASPWEDRAFT_40122-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_40122-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507	KV878212|CGC21	56202.49	4.7926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:960804-962506(+)

Full Sequence      

MRFQSLPWAFALVTPSLASLFPSDHSLQQLSDTKSRAEAVKEAFQHAWDGYNKYAFPHDE
LLPVSNGHGDSRNGWGASAVDALSTAIVMRNADVVNQILDFIPTINFHNTSSSVSLFETT
IRYIGGMLSGYDLLKGPASDLVKNSSNVDALLTQSKTLADVLKFAFDTPSGVPNNDVNII
SKEDDGTKTNGLAVTGSLVLEWTRLSDLTGDDEYAKLTQKAQSYLLNPSPSKYEPFPGLV
GSHIDKETGQFTDGVVSWNGGDDSFYEYLIKMYVYDTKRFGLYRDRWVAAANSSMHHLKS
HPPSRPDLTFLASYEDGKYGLASQHLTCFDGGNFLLGGSVLNRQDFIDFGLELVNGCHDT
YNETLTGIGPESFSWDASAVPADQKELYERAGFYITSGAYILRPEVIESFYYAYRITKNT
MYRDWVWNAFVAINKNCRTDSGFAGLQNVNELNGGGKYDNQESFLFAEVLKYAYLTHSGD
DEWQVNPGAGKNAFVLNTEAHPIRVVQ

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	43	505	7.1e-134	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	43	505	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.48e-115	34	505	70	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57653.1|GH47|3.2.1.113	6.69e-270	1	505	1	508
BAC07247.1|GH47|3.2.1.113	6.69e-270	1	505	1	508
QRD82359.1|GH47	6.69e-270	1	505	1	508
QMW39988.1|GH47	6.69e-270	1	505	1	508
QMW27917.1|GH47	6.69e-270	1	505	1	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.63e-260	34	507	3	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	6.14e-260	34	507	38	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	2.31e-165	31	505	10	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	1.39e-66	34	507	20	469	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.73e-66	34	507	18	467	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	5.83e-276	1	505	1	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	8.60e-275	5	505	7	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	1.19e-270	1	505	1	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.19e-270	1	505	1	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q12563|MNS1B_ASPPH	4.41e-269	9	505	12	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999697	CS pos: 18-19. Pr: 0.9824

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_40122-t33_1-p1.