CAZyme Information: ASPWEDRAFT_40104-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_40104-t33_1-p1
• CAZy Family: GH49
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54671.39	5.0654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878212:913691-915433(+)

Full Sequence      

MTSALATLPSDFLWGFATASYQIEGAVDEDGRGPSIWDKFCEIPGKIADGSSGAVACDSY
HRTYEDIALLKACGAKAYRFSISWSRIIPLGGRNDPINEKGLQFYVKFVDDLLAAGITPL
VTLFHWDLPEGLNQRYGGFLNKEEFVADFTNYARILFNAFGSKVKHWITFNEPWCSSVLG
YNVGQFAPGRTSDRTKSPEGDSSRECWIVGHNLLVAHGAAVKVYREDFKTRDEGEIGITL
NGDWAEPWDPENPADVEACERKIEFSISWFADPIYHGKYPDSMVQQLGDRLPEWTKEDIT
LVHGSNDFYGMNHYCAHYIKAKTTEPDPNDTAGNLEVLMENKAGKSIGPETQSSWLRPYP
LGFRKLLKWISDRYSRPKIYVTENGTSLKGENDLPLDQLLNDEFRTRYFHDYIGAMADAY
TLDRVNVRGYMAWSLMDNFEWADGYKTRFGVTYVDYDNDQKRIPKKSAKAIGDIFKQYIL
TV

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	477	6.3e-164	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	9	469	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	6	469	3	442	Glycosyl hydrolase family 1.
225343	BglB	1.57e-149	7	468	3	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.98e-112	9	476	31	481	beta-glucosidase
215435	PLN02814	1.55e-111	8	468	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82378.1|GH1	0.0	2	479	3	480
QMW27934.1|GH1	0.0	2	479	3	480
UDD55888.1|GH1	0.0	2	479	3	480
QMW40005.1|GH1	0.0	2	479	3	480
CAK47813.1|GH1	0.0	1	479	1	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	3.03e-274	4	479	22	496	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	4.88e-244	8	479	3	463	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	5.37e-241	8	479	3	463	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.07e-240	8	479	22	482	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.54e-237	8	479	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.85e-196	8	479	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.03e-181	6	479	4	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	4.51e-145	9	469	34	496	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.62e-141	7	480	38	509	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	3.25e-141	7	480	38	509	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPWEDRAFT_40104-t33_1-p1.