CAZyme Information: ASPWEDRAFT_39284-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_39284-t33_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	KV878211|CGC13	53858.79	6.4085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878211:3286064-3287543(-)

Full Sequence      

MPSRRVTIPALVLLALCILAFLSFRLGNPSARLLPHSPPSSPSSPDFWTWETVSRFRPSP
SAASSEPDICDSFPSEILPRVQVVLKIGASEPADRIEAQFATATRCISNLIIVSDHEQEL
KSHHVHDIIATLPHSYRVDNTVDFEAYEAFYVNHTIKSNATNTNTEKQMTGAKGWKLDRF
KFLPMVEYAYEVNPTANWFVFIESDTYVVWDNLFRLLDSYNHHTPLYFGSPSPGRKNKDD
ETTWFAYGGAGFVLSSAAVQKAVVRKAGANGEFASPSLTEEYQQLAREDCCGDSILGWVL
YQKGIKLSGLWPMFNPHPLHGIPFDDKHWCQPVITLHKTLYSDMESLSKYEQQRGQKQPL
LYADLIDYHKIGTFEQKTDWDNGDWGGWQEPLESPGHASMAACKAACHDHPECLEYTYDS
SGHCVFVRTVRLGGPKTDLPDGNRLSAGWDLEKIANWRNGRQCEKPLWVKPSITRIF

Enzyme Prediction     

No EC number prediction in ASPWEDRAFT_39284-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	9.66e-12	186	261	75	158	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10791.1|GT31	1.37e-209	2	477	16	481
BCR98451.1|GT31	1.37e-209	2	477	16	481
UDD57328.1|GT31	4.27e-205	3	477	7	477
QMW44383.1|GT31	6.06e-205	3	477	7	477
QRD83812.1|GT31	1.22e-204	3	477	7	477

PDB Hits     

ASPWEDRAFT_39284-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O12971|LFNG_CHICK	5.90e-06	186	328	167	311	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Gallus gallus OX=9031 GN=LFNG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999071	0.000943

TMHMM  Annotations     

Start	End
7	24