CAZyme Information: ASPWEDRAFT_35955-t33_1-p1

Basic Information

• Species: Aspergillus wentii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus wentii
• CAZyme ID: ASPWEDRAFT_35955-t33_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1052	KV878210|CGC1	115733.47	5.5151

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AwentiiDTO134E9	12659	1073089	224	12435

• Gene Location: location=KV878210:755768-759031(-)

Full Sequence      

MPPTAPGSFRDHLKSDDGSSTRKSSGKRYAPLQESIPEEERNTYDDDSDSYSSDETIKLR
RVDPRGAGSAANNSAAYVPAVPDDGNIESYLDSIAEAELELLSASKHDFDVEDDDDFDSE
SEGYTRRRRRERRRSYLERDRLKGWRGYRSSRYFCPALVAVSMGLILLVIGFLGMARYRS
TKKPKYHMVDSASWFPTPRGGSLQHWADSYGKARHMVENMTLIEKINITTGTGWQMGLCV
GNTGSAEHVKFPSLCLQDGPQGLRYADHITAFPAGITTGATWNRTLIRERGNALGREARL
KGVNVLLGPSIGALGMNPAGGRNWESFGSDPVLQGIAAAETIRGIQSNGVMATAKHYVMN
EQEHFRKPYEWGLESALSSNIDDRSLHEVFVWPFAESIRADVASIMCAYQMVNNSYSCEN
SKLLNGLLKDELGFQGFVQSDWQAQRSGVNSALGGLDMSMPGDGLRWANGVSLWGGELTK
AVLNTTIPIERLNDMVSRIVAAWYQLGQDKWEEKVPNFSSWTNDQIGWWHHGSDKNENST
YGEVNRYINAQGSGDQDHSVTARRVAAEGTVLLKNVDDVLPLSRKGSKPGGVYRVGVYGD
DASPAGGPNSCPDKGCNAGTLASGWGSGTVEFPYLVSPVDALAEAWEGENVEFSPYLRNG
VMPVDAEDKDLCLVFANADSGEGYISEGGNHGDRQHLFLQKGGDSLIKTVASHCGNGNGK
TVVVIHAVGPVVMEPWIDLPGVDAVVLANLPGQESGHALVDVLFGDVDASGRLPYTIGKC
IEDYGPSAQVLYEPNAPVPQVDFKEGLYIDYRYFDRYNITPRFEFGYGLSYTKFALSGLK
ISTLRWKSRLPSARPVDPVFPPEYDTTAPNESVLFPPDFNAVNKYIYPYLPTLQGTKPGH
YQYYPKDYKLRQAPSPAGGGAGGNPSLYEEIAEVKVTVTNTGARAGQEVVQLYLSFPPNV
TEVTHPHKPAKADKNQPAPPPVVEEIEFPVRVLRDFSKVALEPGKRQEVRMALRRKDLSY
WSVREQNWVMPDGEFGVWVGRSSRDLALVGSF

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	246	461	5.7e-58	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	2.11e-54	570	811	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	4.29e-46	270	615	81	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	8.45e-42	268	1045	116	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.09e-27	270	499	86	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.57e-25	212	845	52	651	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88876.1|GH3	0.0	7	1052	14	1108
QMW37281.1|GH3	0.0	17	1052	8	1048
QMW25221.1|GH3	0.0	17	1052	8	1048
QRD88836.1|GH3	0.0	17	1052	8	1048
UCK57595.1|GH3	0.0	17	1052	8	1048

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	3.62e-239	180	1048	2	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJI_A	6.65e-239	191	1048	6	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	1.11e-236	185	1051	1	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	6.06e-233	191	1048	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5JU6_A	9.02e-228	187	1048	21	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UTX5|BGLE_ASPOR	0.0	17	1052	8	1048	Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglE PE=3 SV=2
sp|B0YD91|BGLE_ASPFC	0.0	7	1052	10	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglE PE=3 SV=1
sp|Q5AYH8|BGLE_EMENI	0.0	27	1048	3	1017	Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglE PE=3 SV=1
sp|A1CMH6|BGLE_ASPCL	0.0	1	1048	1	1046	Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglE PE=3 SV=1
sp|Q4WD56|BGLE_ASPFU	0.0	7	1052	10	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
153	175